Novus Biologicals products are now on bio-techne.com

RIPK2 Recombinant Protein Antigen

Name: RIPK2 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-86629PEP
Price: 279 USD

Images

There are currently no images for RIPK2 Protein (NBP1-86629PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

RIPK2 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RIPK2. Source: E. coli Amino Acid Sequence: ITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQ Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	RIPK2
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86629. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for RIPK2 Recombinant Protein Antigen

CARD3
CARD-containing IL-1 beta ICE-kinase
CARD-containing interleukin-1 beta-converting enzyme (ICE)-associated kinase
CARD-containing interleukin-1 beta-converting enzyme-associated kinase
CARDIAKCCK
EC 2.7.11
EC 2.7.11.1
GIG30
growth-inhibiting gene 30
receptor interacting protein 2
receptor-interacting protein (RIP)-like interacting caspase-like apoptosisregulatory protein (CLARP) kinase
Receptor-interacting protein 2
receptor-interacting serine/threonine-protein kinase 2
receptor-interacting serine-threonine kinase 2
RICK
RICKGIG30
RIP2
RIP-2
RIP2CARD-carrying kinase
RIPK2
RIP-like-interacting CLARP kinase

Background

RIPK2 encodes a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases. The encoded protein contains a C-terminal caspase activation and recruitment domain (CARD), and is a component of signaling complexes in both the innate and adaptive immune pathways. It is a potent activator of NF-kappaB and inducer of apoptosis in response to various stimuli.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cholecystokinin-B
R/CCKBR Antibody

NB100-2803

Immunohistochemistry Cholecystokinin-B R/CCKBR Antibody

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, PEP-ELISA, WB

CCK-AR Antibody
[Unconjugated]

AF2680

(2 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

Gastrin Antibody

NBP3-12223

Species: Hu, Pm, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB

Somatostatin
Antibody (7G5) - BSA

NBP2-37447

Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free

ELISA Somatostatin Antibody (7G5) - BSA Free

(1 Review)

(3 Publications)

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB

VIP Antibody
(OTI1E8)

NBP2-46349

Species: Hu

Applications: IHC, WB

Secretin Antibody

NBP2-48988

Species: Hu

Applications: IHC, IHC-P

Gastrin-releasing
Peptide/Bombesin/Neur ...

NBP3-03282

Immunohistochemistry-Paraffin Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody - BSA Free

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Pancreatic
Polypeptide/PP Antibo

NB100-1793

Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody

Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody

(3 Reviews)

(19 Publications)

Species: Hu, Pm, Mu, Rt

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

Neuropeptide Y
Antibody

NBP1-46535

(20 Publications)

Species: Hu, Mu, Rb, Rt, Xp

Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB

Neurotensin
Antibody

NBP2-33903

Species: Hu

Applications: IHC, IHC-P

Peptide YY Antibody

NBP1-80865

(3 Publications)

Species: Hu

Applications: IHC, IHC-P

Substance P
Antibody (266815)

MAB4375

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt

Applications: IHC

POMC Antibody

NB100-1533

(10 Publications)

Species: Hu, Mu, Po, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Glucagon Antibody
(181402) [Unconjugate ...

MAB1249

Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]

(1 Review)

(13 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, ICC, ICFlow

PTK7/CCK4 Antibody
[Unconjugated]

AF4499

Simple Western PTK7/CCK4 Antibody [Unconjugated]

(1 Review)

(9 Publications)

Species: Hu, Mu, Rt

Applications: Simple Western, WB

Leptin/OB [HRP]

DLP00

(151 Publications)

Species: Hu

Applications: ELISA

Inorganic
Pyrophosphatase/PPA1

NBP1-31348

Immunohistochemistry-Paraffin Inorganic Pyrophosphatase/PPA1 Antibody

Western Blot Inorganic Pyrophosphatase/PPA1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(807 Publications)

Species: Hu

Applications: BA

Publications for RIPK2 Protein (NBP1-86629PEP) (0)

There are no publications for RIPK2 Protein (NBP1-86629PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RIPK2 Protein (NBP1-86629PEP) (0)

There are no reviews for RIPK2 Protein (NBP1-86629PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for RIPK2 Protein (NBP1-86629PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional RIPK2 Products

Research Areas for RIPK2 Protein (NBP1-86629PEP)

Find related products by research area.

Blogs on RIPK2

There are no specific blogs for RIPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our RIPK2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

RIPK2

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

RIPK2 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

RIPK2 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for RIPK2 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for RIPK2 Protein (NBP1-86629PEP) (0)

Reviews for RIPK2 Protein (NBP1-86629PEP) (0)

FAQs for RIPK2 Protein (NBP1-86629PEP) (0)

Additional RIPK2 Products

Research Areas for RIPK2 Protein (NBP1-86629PEP)

Blogs on RIPK2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics