![Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Gastrin-releasing-Peptide-Bombesin-Neuromedin-C-Antibody-Western-Blot-NBP3-03282-img0004.jpg "Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-148 of human Gastrin-releasing Peptide/Bombesin/Neuromedin C (NP_002082.2). MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GRP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody (NBP3-03282)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GRP |
![Immunocytochemistry/Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Immunofluorescence analysis of HeLa cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Gastrin-releasing-Peptide-Bombesin-Neuromedin-C-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03282-img0001.jpg "Immunocytochemistry/Immunofluorescence: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Immunofluorescence analysis of HeLa cells using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at dilution of 1:100. Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Mouse heart using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Gastrin-releasing-Peptide-Bombesin-Neuromedin-C-Antibody-Immunohistochemistry-Paraffin-NBP3-03282-img0003.jpg "Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Mouse heart using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Gastrin-releasing Peptide-Bombesin-Neuromedin C Antibody-Western Blot-NBP3-03282-img0005.jpg "Western Blot: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Analysis of extracts of various cell lines, using Gastrin-releasing Peptide/Bombesin/Neuromedin C antibody (NBP3-03282) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 180s.")
![Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Rat brain using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Gastrin-releasing-Peptide-Bombesin-Neuromedin-C-Antibody-Immunohistochemistry-Paraffin-NBP3-03282-img0002.jpg "Immunohistochemistry-Paraffin: Gastrin-releasing Peptide/Bombesin/Neuromedin C Antibody [NBP3-03282] - Rat brain using Gastrin-releasing Peptide/Bombesin/Neuromedin C Rabbit pAb (NBP3-03282) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Western_Blot_19926.jpg)
![Immunohistochemistry Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Immunohistochemistry_15337.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")