Home » PUF60 » PUF60 Antibodies » PUF60 Antibody
Novus Biologicals products are now on bio-techne.com

PUF60 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PUF60 Antibody [NBP2-49032] - Analysis using Anti-PUF60 antibody NBP2-49032 (A) shows similar pattern to independent antibody NBP2-49303 (B).
Independent Antibodies: Western Blot: PUF60 Antibody [NBP2-49032] - Analysis using Anti-PUF60 antibody NBP2-49032 (A) shows similar pattern to independent antibody NBP2-49303 (B).
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human kidney.
Immunohistochemistry: PUF60 Antibody [NBP2-49032] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining in human testis and pancreas tissues using anti-PUF60 antibody. Corresponding PUF60 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human cerebral cortex, colon, kidney and testis using Anti-PUF60 antibody NBP2-49032 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human colon.
Immunohistochemistry-Paraffin: PUF60 Antibody [NBP2-49032] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

      

Orthogonal Strategies

  

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PUF60 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AATAKITAQEAVAGAAVLGTLGTPGLVSPALTLAQPLGTLPQAVMAAQAPGVITGVTPARPPIPVTIPSVGVVNPILASPPTL
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PUF60
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PUF60 Recombinant Protein Antigen (NBP2-49032PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PUF60 Antibody

  • FBP interacting repressor
  • FBP-interacting repressor
  • FIRpoly-U binding splicing factor PUF60
  • FLJ31379
  • FUSE-binding protein-interacting repressor
  • poly(U)-binding-splicing factor PUF60
  • poly-U binding splicing factor 60KDa
  • Ro ribonucleoprotein binding protein 1
  • Ro ribonucleoprotein-binding protein 1
  • Ro-binding protein 1
  • roBP1
  • RoBPI
  • siah binding protein 1,60 kDa poly(U)-binding-splicing factor
  • Siah-binding protein 1
  • siah-BP1
  • SIAHBP1pyrimidine tract binding splicing factor

Background

PUF60 is a Ro RNP-binding protein. It interacts with Ro RNPs and their interaction is thought to represent a gain of function for Ro RNPs. PUF60 also forms a ternary complex with far upstream element (FUSE) and FUSE-binding protein. It can repress a c-myc reporter via the FUSE. It is also known to target transcription factor IIH and inhibit activated transcription. PUF60 gene is implicated in the xeroderma pigmentosum disorder. There are two alternatively spliced transcript variants of this gene encoding different isoforms. There seems to be evidence of multiple polyadenylation sites for PUF60 gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
XPB Antibody
NB100-61060
Immunoprecipitation XPB Antibody
Western Blot XPB Antibody
Western Blot XPB Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
FUBP1 Antibody
NBP1-83918
Immunocytochemistry/ Immunofluorescence FUBP1 Antibody
Immunohistochemistry-Paraffin FUBP1 Antibody
Immunohistochemistry-Paraffin FUBP1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
GTF2H5
Overexpression Lysate
NBL1-11392
Western Blot GTF2H5 Overexpression Lysate
Species: Hu
Applications: WB
GTF2H4 Antibody
H00002968-B01P
Western Blot GTF2H4 Antibody
Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody
Species: Hu
Applications: ICC/IF, WB
GTF2H2 Antibody
(PCRP-GTF2H2-1B9)
NBP3-07348
Protein Array GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Flow Cytometry GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Immunocytochemistry/ Immunofluorescence GTF2H2 Antibody (PCRP-GTF2H2-1B9)
Species: Hu
Applications: Flow, ICC/IF, PA
GTF2H3 Antibody
NBP2-87539
Immunohistochemistry-Paraffin GTF2H3 Antibody
Western Blot GTF2H3 Antibody
Immunohistochemistry GTF2H3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GTF2H1 Antibody
(1F12-1B5)
H00002965-M01
Western Blot GTF2H1 Antibody (1F12-1B5)
Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5)
Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
FBPase 1 Antibody
NBP1-84721
Immunohistochemistry-Paraffin FBPase 1 Antibody
Immunohistochemistry-Paraffin FBPase 1 Antibody
Immunohistochemistry-Paraffin FBPase 1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
RAB14 Antibody
NBP1-84720
Immunocytochemistry/ Immunofluorescence RAB14 Antibody
Western Blot RAB14 Antibody
Immunohistochemistry-Paraffin RAB14 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
FOLR1 Antibody
(548908) [Unconjugate
MAB5646
Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]
Western Blot FOLR1 Antibody (548908) [Unconjugated]
Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]
(2 Reviews)
(12 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, KO, WB
FOLR2 Antibody
AF5697
Immunocytochemistry FOLR2 Antibody
Western Blot FOLR2 Antibody
(4 Publications)
Species: Hu
Applications: ICC, WB
MARCH8 Antibody
NBP1-85540
Western Blot MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MLXIP Antibody
NBP2-85297
Immunohistochemistry-Paraffin MLXIP Antibody
Western Blot MLXIP Antibody
Western Blot MLXIP Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MYLIP Antibody
(OTI3A2)
NBP2-46069
Western Blot MYLIP Antibody (OTI3A2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
SAP155 Antibody
(6C7)
NBP3-26326
Immunohistochemistry SAP155 Antibody (6C7)
Immunohistochemistry SAP155 Antibody (6C7)
Western Blot SAP155 Antibody (6C7)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
FARP2 Antibody
NBP1-84680
Western Blot FARP2 Antibody
Immunohistochemistry-Paraffin FARP2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
SSB Antibody
(OTI2C8)
NBP1-48002
Western Blot SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for PUF60 Antibody (NBP2-49032) (0)

There are no publications for PUF60 Antibody (NBP2-49032).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PUF60 Antibody (NBP2-49032) (0)

There are no reviews for PUF60 Antibody (NBP2-49032). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PUF60 Antibody (NBP2-49032) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PUF60 Products

Blogs on PUF60

There are no specific blogs for PUF60, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PUF60 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PUF60