![Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-84720-img0015.jpg "Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line RH-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQ |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB14 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 28294115). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control |
|
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
| Publication using NBP1-84720 | Applications | Species |
|---|---|---|
| Gundry C, Marco S, Rainero E et al. Phosphorylation of Rab-coupling protein by LMTK3 controls Rab14-dependent EphA2 trafficking to promote cell:cell repulsion. Nat Commun. 2017-03-15 [PMID: 28294115] (WB, Human) | WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB14 Antibody (NBP1-84720)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB14 |
![Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-84720] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84720-img0008.jpg "Immunocytochemistry/Immunofluorescence: RAB14 Antibody [NBP1-84720] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.")
![Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunohistochemistry-Paraffin-NBP1-84720-img0014.jpg "Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line TD47D.](http://images.novusbio.com/fullsize/RAB14-Antibody-Western-Blot-NBP1-84720-img0010.jpg "Western Blot: RAB14 Antibody [NBP1-84720] - Analysis in human cell line TD47D.")
![Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunohistochemistry-Paraffin-NBP1-84720-img0007.jpg "Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.")
![Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunohistochemistry-NBP1-84720-img0011.jpg "Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunohistochemistry-Paraffin-NBP1-84720-img0012.jpg "Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human gastrointestinal shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RAB14-Antibody-Immunohistochemistry-Paraffin-NBP1-84720-img0013.jpg "Immunohistochemistry-Paraffin: RAB14 Antibody [NBP1-84720] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")