![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0007.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MLXIP. Peptide sequence: DEQGCEHTSRTEDPFIQPTDFGPSEPPLSVPQPFLPVFTMPLLSPSPAPP The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MLXIP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MLXIP |
![Immunohistochemistry-Paraffin: MLXIP Antibody [NBP2-85297] - Rabbit Anti-MLXIP Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.](http://images.novusbio.com/fullsize/MLXIP-Antibody-Immunohistochemistry-Paraffin-NBP2-85297-img0001.jpg "Immunohistochemistry-Paraffin: MLXIP Antibody [NBP2-85297] - Rabbit Anti-MLXIP Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody Concentration: 1:200. Magnification: 20X.")
![Western Blot: MLXIP Antibody [NBP2-85297] - WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0002.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - WB Suggested Anti-MLXIP Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: PANC1 cell lysateMLXIP is supported by BioGPS gene expression data to be expressed in PANC1")
![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0003.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml")
![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0004.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml")
![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0005.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml")
![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0006.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml")
![Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlMLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3](http://images.novusbio.com/fullsize/MLXIP-Antibody-Western-Blot-NBP2-85297-img0008.jpg "Western Blot: MLXIP Antibody [NBP2-85297] - Host: Rabbit. Target Name: MLXIP. Sample Type: OVCAR-3. Antibody Dilution: 1.0ug/mlMLXIP is supported by BioGPS gene expression data to be expressed in OVCAR3")
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_21534.jpg)
![Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Immunohistochemistry_11463.jpg)
![Western Blot Cathepsin C/DPPI Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_C_AF1034_Western_Blot_16948.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot MLX Antibody [Unconjugated]](https://images.novusbio.com/images2/MLX_AF4186_Western_Blot_5416.jpg)
![Immunocytochemistry MLX Antibody [Unconjugated]](https://images.novusbio.com/images2/af4186_human-mlx-affinity-purified-polyclonal-ab-immunocytochemistry-412202015556.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")