![Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/Protocadherin-21-Antibody-Immunohistochemistry-Paraffin-NBP1-92296-img0010.jpg "Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human testis shows no positivity in cells in seminiferous ducts as expected.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDHR1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Protocadherin-10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Protocadherin-10 [Unconjugated]")
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
IHC-Fr | Rat | 05/09/2018 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Protocadherin 21 Antibody (NBP1-92296)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDHR1 |
![Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296] - Strong protocadherin 21 (Pcdh21) labelling of mitral and tufted cells in the rat olfactory bulb (PND 15). Perfusion with 4% PFA, 30 um Cryocut brain slices. Image submitted by a verified customer review](http://images.novusbio.com/fullsize/Protocadherin-21-Antibody-Immunohistochemistry-Frozen-NBP1-92296-img0005.jpg "Immunohistochemistry-Frozen: Protocadherin 21 Antibody [NBP1-92296] - Strong protocadherin 21 (Pcdh21) labelling of mitral and tufted cells in the rat olfactory bulb (PND 15). Perfusion with 4% PFA, 30 um Cryocut brain slices. Image submitted by a verified customer review")
![Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human eye, retina shows moderate cytoplasmic and membranous positivity in cells in photoreceptor layer.](http://images.novusbio.com/fullsize/Protocadherin-21-Antibody-Immunohistochemistry-Paraffin-NBP1-92296-img0006.jpg "Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human eye, retina shows moderate cytoplasmic and membranous positivity in cells in photoreceptor layer.")
![Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/Protocadherin-21-Antibody-Immunohistochemistry-Paraffin-NBP1-92296-img0007.jpg "Immunohistochemistry-Paraffin: Protocadherin 21 Antibody [NBP1-92296] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry: Protocadherin 21 Antibody [NBP1-92296] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Protocadherin-21-Antibody-Immunohistochemistry-NBP1-92296-img0008.jpg "Immunohistochemistry: Protocadherin 21 Antibody [NBP1-92296] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Western_Blot_5749.jpg)
![Immunohistochemistry GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Immunohistochemistry_11477.jpg)
![Flow Cytometry GPER/GPR30 Antibody [Unconjugated]](https://images.novusbio.com/images2/GPER_AF5534_Flow_Cytometry_22083.jpg)
![Immunocytochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Immunocytochemistry_10774.jpg)
![Western Blot Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin-15_AF6729_Western_Blot_11962.jpg)
![Immunohistochemistry Protocadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Protocadherin15_AF6729_Immunohistochemistry_19790.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
