![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining in human colon and lymph node tissues using anti-TST antibody. Corresponding TST RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0010.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining in human colon and lymph node tissues using anti-TST antibody. Corresponding TST RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VHQVLYRALVSTKWLAESIRTGKLGPGLRVLDASWYSPGTREARKEYLERHVPGASFFDIEECRDTASPYEMMLPSEAGFAEYVGRLGISNHTHVVVYDGEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPS |
| Predicted Species | Mouse (91%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TST |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-87148 | Applications | Species |
|---|---|---|
| Sabelli R, Iorio E, De Martino A et al. Rhodanese-thioredoxin system and allyl sulfur compounds. FEBS J 2008-08-01 [PMID: 18616471] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TST |
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon, kidney, liver and pancreas using Anti-TST antibody NBP1-87148 (A) shows similar protein distribution across tissues to independent antibody NBP1-87147 (B).](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0011.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon, kidney, liver and pancreas using Anti-TST antibody NBP1-87148 (A) shows similar protein distribution across tissues to independent antibody NBP1-87147 (B).")
![Western Blot: TST Antibody [NBP1-87148] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/TST-Antibody-Western-Blot-NBP1-87148-img0006.jpg "Western Blot: TST Antibody [NBP1-87148] - Analysis in human liver tissue.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human kidney.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0014.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon shows high expression.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0008.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon shows high expression.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human lymph node shows low expression as expected.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0009.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human lymph node shows low expression as expected.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human pancreas.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0012.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human pancreas.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human liver.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0013.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human liver.")
![Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon using Anti-TST antibody NBP1-87148.](http://images.novusbio.com/fullsize/TST-Antibody-Immunohistochemistry-Paraffin-NBP1-87148-img0015.jpg "Immunohistochemistry-Paraffin: TST Antibody [NBP1-87148] - Staining of human colon using Anti-TST antibody NBP1-87148.")
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/Follistatin_DFN00_ELISA_97.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_681.jpg)
![N/A Follistatin [HRP]](https://images.novusbio.com/images2/DATA_Follistatin_DFN00_ELISA_682.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Neutralization LIFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/LIF_R_alpha_AF-249-NA_Block_Neutralize_8665.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")