![Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis using Anti-MZB1 antibody NBP1-92287 (A) shows similar pattern to independent antibody NBP2-55874 (B).](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Western-Blot-NBP1-92287-img0014.jpg "Western Blot: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis using Anti-MZB1 antibody NBP1-92287 (A) shows similar pattern to independent antibody NBP2-55874 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MZB1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Proapoptotic Caspase Adaptor Protein Antibody (NBP1-92287)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MZB1 |
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0020.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver, lymph node, placenta and small intestine using Anti-MZB1 antibody NBP1-92287 (A) shows similar protein distribution across tissues to independent antibody NBP2-55874 (B).](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0015.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human liver, lymph node, placenta and small intestine using Anti-MZB1 antibody NBP1-92287 (A) shows similar protein distribution across tissues to independent antibody NBP2-55874 (B).")
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis in human lymph node and liver tissues using NBP1-92287 antibody. Corresponding MZB1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0016.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Analysis in human lymph node and liver tissues using NBP1-92287 antibody. Corresponding MZB1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0017.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human lymph node shows strong cytoplasmic positivity in a subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0018.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human placenta shows no positivity in trophoblastic cells as expected.](http://images.novusbio.com/fullsize/Proapoptotic-Caspase-Adaptor-Protein-Antibody-Immunohistochemistry-Paraffin-NBP1-92287-img0019.jpg "Immunohistochemistry-Paraffin: Proapoptotic Caspase Adaptor Protein Antibody [NBP1-92287] - Staining of human placenta shows no positivity in trophoblastic cells as expected.")
![Western Blot PACAP/ADCYAP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PACAP_AF6380_Western_Blot_10225.jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")