![Immunocytochemistry/Immunofluorescence: PIWIL1/HIWI Antibody [NBP3-17007] - Analysis in human testis and endometrium tissues using Anti-PIWIL1 antibody. Corresponding PIWIL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PIWIL1-HIWI-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-17007-img0001.jpg "Immunocytochemistry/Immunofluorescence: PIWIL1/HIWI Antibody [NBP3-17007] - Analysis in human testis and endometrium tissues using Anti-PIWIL1 antibody. Corresponding PIWIL1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPL |
| Predicted Species | Mouse (98%), Rat (98%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIWIL1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PIWIL1 |
![Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP3-17007] - Staining of human endometrium shows low expression as expected.](http://images.novusbio.com/fullsize/PIWIL1-HIWI-Antibody-Immunohistochemistry-Paraffin-NBP3-17007-img0002.jpg "Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP3-17007] - Staining of human endometrium shows low expression as expected.")
![Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP3-17007] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize/PIWIL1-HIWI-Antibody-Immunohistochemistry-Paraffin-NBP3-17007-img0003.jpg "Immunohistochemistry-Paraffin: PIWIL1/HIWI Antibody [NBP3-17007] - Staining of human testis shows high expression.")
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Immunocytochemistry Goosecoid Antibody [Unconjugated]](https://images.novusbio.com/images2/Goosecoid_AF4086_Immunocytochemistry__Immunofluorescence_20128.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")