Orthogonal Strategies: Western Blot: PDLIM7 Antibody [NBP1-84841] - Analysis in human cell lines U2OS and HEK293 using Anti-PDLIM7 antibody. Corresponding PDLIM7 RNA-seq data are presented for the same cell ...read more
Independent Antibodies: Western Blot: PDLIM7 Antibody [NBP1-84841] - Analysis using Anti-PDLIM7 antibody NBP1-84841 (A) shows similar pattern to independent antibody NBP2-58734 (B).
Immunocytochemistry/ Immunofluorescence: PDLIM7 Antibody [NBP1-84841] - Staining of human cell line U-251 MG shows localization to actin filaments and focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PDLIM7 Antibody [NBP1-84841] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.
Western Blot: PDLIM7 Antibody [NBP1-84841] - PDLIM5/7 proteins localize in the cytoplasm in dense cells but to basal stress fibers in sparse cells and bind directly to the stress fiber component alpha-actinin 1. ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: HLTGTEFMQDPDEEHLKKSSQVPRTEAPAPASSTPQEPWPGPTAPSPTSRPPWAVDPAFAERYAPDKTSTVLTR
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PDLIM7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for PDLIM7 Antibody
1110003B01Rik
ENIGMAProtein enigma
LIM domain protein
LIM mineralization protein
LMP
LMP1
PDZ and LIM domain 7 (enigma)
PDZ and LIM domain protein 7
Background
PDLIM7 is encoded by this gene is representative of a family of proteins composed of conserved PDZ and LIM domains. LIM domains are proposed to function in protein-protein recognition in a variety of contexts including gene transcription and development and in cytoskeletal interaction. The LIM domains of this protein bind to protein kinases, whereas the PDZ domain binds to actin filaments. The gene product is involved in the assembly of an actin filament-associated complex essential for transmission of ret/ptc2 mitogenic signaling. The biological function is likely to be that of an adapter, with the PDZ domain localizing the LIM-binding proteins to actin filaments of both skeletal muscle and nonmuscle tissues. Alternative splicing of this gene results in multiple transcript variants.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our PDLIM7 Antibody and receive a gift card or discount.