Home » PA1 » PA1 Proteins » PA1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PA1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PA1 Protein (NBP1-89792PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PA1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAGR1.

Source: E. coli

Amino Acid Sequence: HMPTEFDFDDEPVTPKDSLIDRRRTPGSSARSQKREARLDKVLSDMKRHKKLEEQILRTGRDLFSLDSEDPSPASPPLRSSGSSLFPRQR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAGR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89792.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PA1 Recombinant Protein Antigen

  • chromosome 16 open reading frame 53
  • FLJ22459
  • GAS
  • glutamate-rich coactivator interacting with SRC1/NCOA1
  • MGC4606
  • PA1
  • PAXIP1-associated protein 1
  • PTIP-associated 1 protein
  • PTIP-associated protein 1

Background

C16ORF53 (PA1) is a component of a Set1-like multiprotein histone methyltransferase complex (Cho et al., 2007 [PubMed 17500065]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

STAT1 [p Tyr701]
Antibody [Unconjugate ...
AF2894
Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]
Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]
Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(452 Publications)
Species: Hu
Applications: BA
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western Blot STAT5a/b Antibody [Unconjugated] - Pan Specific
Simple Western STAT5a/b Antibody [Unconjugated] - Pan Specific
Chromatin Immunoprecipitation (ChIP) STAT5a/b Antibody [Unconjugated] - Pan Specific
(28 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Muscarinic
Acetylcholine Recepto ...
NBP1-87466
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunohistochemistry-Paraffin Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
Immunocytochemistry/ Immunofluorescence Muscarinic Acetylcholine Receptor M1/CHRM1 Antibody
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
STAT5b Antibody
[Unconjugated]
AF1584
Simple Western STAT5b Antibody [Unconjugated]
Knockout Validated STAT5b Antibody [Unconjugated]
Immunocytochemistry STAT5b Antibody [Unconjugated]
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
SOAT1 Antibody
NB400-141
SOAT1 Antibody
(7 Publications)
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry Jak2 Antibody (53B7) - BSA Free
Immunocytochemistry/ Immunofluorescence Jak2 Antibody (53B7) - BSA Free
Western Blot Jak2 Antibody (53B7) - BSA Free
(3 Reviews)
(3 Publications)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
iNOS Antibody -
BSA Free
NB300-605
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
Western Blot iNOS Antibody - BSA Free
(3 Reviews)
(130 Publications)
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Plasminogen
Antibody
NB600-930
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
Western Blot Plasminogen Antibody
(2 Reviews)
(6 Publications)
Species: Hu, Rt
Applications: ELISA, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(661 Publications)
Species: Mu
Applications: ELISA
Gastrin Antibody
NBP3-12223
Immunohistochemistry-Paraffin Gastrin Antibody
Unknown Gastrin Antibody
Species: Hu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
Western Blot STAT3 Antibody (232209) [Unconjugated]
Knockout Validated STAT3 Antibody (232209) [Unconjugated]
(22 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EMMPRIN/CD147
Antibody [Unconjugate
AF972
Western Blot EMMPRIN/CD147 Antibody [Unconjugated]
Immunohistochemistry EMMPRIN/CD147 Antibody [Unconjugated]
Knockout Validated EMMPRIN/CD147 Antibody [Unconjugated]
(1 Review)
(15 Publications)
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
PA1 Recombinant
Protein Antigen
NBP1-89792PEP
PA1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PA1 Protein (NBP1-89792PEP) (0)

There are no publications for PA1 Protein (NBP1-89792PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PA1 Protein (NBP1-89792PEP) (0)

There are no reviews for PA1 Protein (NBP1-89792PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PA1 Protein (NBP1-89792PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PA1 Products

Array NBP1-89792PEP

Research Areas for PA1 Protein (NBP1-89792PEP)

Find related products by research area.

Blogs on PA1

There are no specific blogs for PA1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PA1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAGR1