Nurr1/NGFI-B beta/NR4A2 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP |
Predicted Species |
Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NR4A2 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Publications |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Nurr1/NGFI-B beta/NR4A2 Antibody
Background
The Nurr1 gene encodes a member of the steroid-thyroid hormone- retinoid receptor superfamily. The encoded protein may act as a transcription factor. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson's. Nurr1 is a stem cell marker and cooperates with PITX3 to promote terminal maturation of murine and human embryonic stem cell cultures to a midbrain dopamine neuron phenotype. In addition, Nurr1 is involved in the regulation of corticotropin-releasing hormone (CRH), which may be linked to and associated with rheumatoid arthritis.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu(-), Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: Bind, BA
Species: Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, S-ELISA, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Rt
Applications: IHC
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Publications for Nurr1/NGFI-B beta/NR4A2 Antibody (NBP1-87765)(2)
Showing Publications 1 -
2 of 2.
Reviews for Nurr1/NGFI-B beta/NR4A2 Antibody (NBP1-87765) (0)
There are no reviews for Nurr1/NGFI-B beta/NR4A2 Antibody (NBP1-87765).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nurr1/NGFI-B beta/NR4A2 Antibody (NBP1-87765) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nurr1/NGFI-B beta/NR4A2 Products
Research Areas for Nurr1/NGFI-B beta/NR4A2 Antibody (NBP1-87765)
Find related products by research area.
|
Blogs on Nurr1/NGFI-B beta/NR4A2