NIP Antibody Summary
Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen |
The specific Immunogen is proprietary information. Peptide sequence PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL. The peptide sequence for this immunogen was taken from within the described region. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
DUOXA1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Theoretical MW |
53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS, 2% Sucrose |
Preservative |
0.09% Sodium Azide |
Concentration |
0.5 mg/ml |
Purity |
Affinity purified |
Alternate Names for NIP Antibody
Background
NIP, also referred to as Dual oxidase maturation factor 1 (DUOXA1), contains a 38 kDa, a 54 kDa, and a 33 kDa isoform, and is involved in the maturation of the DUOX complex, which produces hydrogen peroxide for thyroid hormonogenesis. Current research is being conducted on NIP and its relation to several disorders and diseases, such as aortic valve insufficiency, hypothyroidism, thyroiditis, and breast cancer. NIP has not been found to interact with other proteins, but has been linked to the processes of protein transport and neuron differentiation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Hu, Pm, Mu, Rb
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Ca, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for NIP Antibody (NBP1-79883) (0)
There are no publications for NIP Antibody (NBP1-79883).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NIP Antibody (NBP1-79883) (0)
There are no reviews for NIP Antibody (NBP1-79883).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NIP Antibody (NBP1-79883). (Showing 1 - 1 of 1 FAQ).
-
I am trying to find out whether your a-NIP antibody catalog number NBP1-79883 is suitable for use in Flow Cytometry?
- NBP1-79883 has not been tested in Flow Cytometry and we cannot guarantee its performance. If you would be interested in testing this antibody in Flow Cytometry, we can recommend our Innovators Reward Program is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.
Secondary Antibodies
| |
Isotype Controls
|
Additional NIP Products
Blogs on NIP