![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Nek1 expression in luminal cells of 12 weeks TRAMP mice prostate tissue. IHC-P image submitted by a verified customer review.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0011.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Nek1 expression in luminal cells of 12 weeks TRAMP mice prostate tissue. IHC-P image submitted by a verified customer review.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPLDELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEGEKYKPLITGEKKVQCISHEINPSA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NEK1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2), 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Arrigo DeBenedetti |
IHC-P | Mouse | 10/06/2020 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for NEK1 Antibody (NBP1-82884)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NEK1 |
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Analysis in human testis and skin tissues. Corresponding NEK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0005.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Analysis in human testis and skin tissues. Corresponding NEK1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human endometrium shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0006.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human endometrium shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0007.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human Fallopian tube shows strong cytoplasmic/ membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0008.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human colon, lymph node, placenta and testis using Anti-GATAD2A antibody (A) NBP1-82884 shows similar protein distribution across tissues to independent antibody NBP1-82883 (B).](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0010.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human colon, lymph node, placenta and testis using Anti-GATAD2A antibody (A) NBP1-82884 shows similar protein distribution across tissues to independent antibody NBP1-82883 (B).")
![Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NEK1-Antibody-Immunohistochemistry-Paraffin-NBP1-82884-img0009.jpg "Immunohistochemistry-Paraffin: NEK1 Antibody [NBP1-82884] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot AKT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Akt2_AF23151_Western_Blot_5185.jpg)
![Immunohistochemistry AKT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Akt2_AF23151_Immunohistochemistry_21059.jpg)
![Immunohistochemistry AKT2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Akt2_AF23151_Immunohistochemistry_21060.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
