![Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in NIH/3T3.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Western-Blot-H00091754-M01-img0014.jpg "Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in NIH/3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 1F6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NEK9 (AAH09336, 226 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AGKGTPLTPPACACSSLQVEVERLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKPDLDSDSWCLLGTDSCRPSL |
| Specificity | NEK9 - NIMA (never in mitosis gene a)- related kinase 9 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NEK9 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate, transfected lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunocytochemistry Polycystin-1/PKD1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Polycystin1_AF6270_Immunocytochemistry__Immunofluorescence_20130.jpg)
| Publication using H00091754-M01 | Applications | Species |
|---|---|---|
| Konig S, Probst-Kepper M, Reinl T et al. First insight into the kinome of human regulatory T cells. PLoS One. 2012-07-16 [PMID: 22815858] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NEK9 Antibody (H00091754-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of monoclonal antibody to NEK9 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Immunocytochemistry-Immunofluorescence-H00091754-M01-img0009.jpg "Immunocytochemistry/Immunofluorescence: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of monoclonal antibody to NEK9 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6 Analysis of NEK9 expression in HeLa.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Western-Blot-H00091754-M01-img0011.jpg "Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6 Analysis of NEK9 expression in HeLa.")
![Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in PC-12.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Western-Blot-H00091754-M01-img0012.jpg "Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in PC-12.")
![Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in Raw 264.7.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Western-Blot-H00091754-M01-img0013.jpg "Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - NEK9 monoclonal antibody (M01), clone 1F6. Analysis of NEK9 expression in Raw 264.7.")
![Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.Lane 1: NEK9 transfected lysate(107.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Western-Blot-H00091754-M01-img0015.jpg "Western Blot: NEK9 Antibody (1F6) [H00091754-M01] - Analysis of NEK9 expression in transfected 293T cell line by NEK9 monoclonal antibody (M01), clone 1F6.Lane 1: NEK9 transfected lysate(107.2 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: NEK9 Antibody (1F6) [H00091754-M01] - Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NEK9-Antibody-1F6-Sandwich-ELISA-H00091754-M01-img0010.jpg "Sandwich ELISA: NEK9 Antibody (1F6) [H00091754-M01] - Detection limit for recombinant GST tagged NEK9 is approximately 0.03ng/ml as a capture antibody.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
