![Western Blot: NDUFA8 Antibody [NBP1-82661] - Analysis using Anti-NDUFA8 antibody NBP1-82661 (A) shows similar pattern to independent antibody NBP1-82662 (B).](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Western-Blot-NBP1-82661-img0007.jpg "Western Blot: NDUFA8 Antibody [NBP1-82661] - Analysis using Anti-NDUFA8 antibody NBP1-82661 (A) shows similar pattern to independent antibody NBP1-82662 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: YWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NDUFA8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NDUFA8 Antibody (NBP1-82661)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NDUFA8 |
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human liver.](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0010.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human liver.")
![Western Blot: NDUFA8 Antibody [NBP1-82661] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Western-Blot-NBP1-82661-img0005.jpg "Western Blot: NDUFA8 Antibody [NBP1-82661] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0002.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human cerebral cortex, colon, kidney and liver using Anti-NDUFA8 antibody NBP1-82661 (A) shows similar protein distribution across tissues to independent antibody NBP1-82662 (B).](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0006.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human cerebral cortex, colon, kidney and liver using Anti-NDUFA8 antibody NBP1-82661 (A) shows similar protein distribution across tissues to independent antibody NBP1-82662 (B).")
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human kidney.](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0008.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0009.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human colon.](http://images.novusbio.com/fullsize/NDUFA8-Antibody-Immunohistochemistry-Paraffin-NBP1-82661-img0011.jpg "Immunohistochemistry-Paraffin: NDUFA8 Antibody [NBP1-82661] - Staining of human colon.")
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![Norrin/NDP Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Norrin/NDP Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")