![Western Blot: GSTZ1 Antibody [NBP1-83320] - Analysis in human liver tissue.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Western-Blot-NBP1-83320-img0007.jpg "Western Blot: GSTZ1 Antibody [NBP1-83320] - Analysis in human liver tissue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTZ1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSTZ1 |
![Immunocytochemistry/Immunofluorescence: GSTZ1 Antibody [NBP1-83320] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83320-img0006.jpg "Immunocytochemistry/Immunofluorescence: GSTZ1 Antibody [NBP1-83320] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.")
![Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-83320-img0010.jpg "Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
![Western Blot: GSTZ1 Antibody [NBP1-83320] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Western-Blot-NBP1-83320-img0004.jpg "Western Blot: GSTZ1 Antibody [NBP1-83320] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-83320-img0002.jpg "Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human liver shows strong cytoplasmic and nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and in glomeruli.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-83320-img0008.jpg "Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules and in glomeruli.")
![Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-83320-img0009.jpg "Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and leydig cells.](http://images.novusbio.com/fullsize/GSTZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-83320-img0011.jpg "Immunohistochemistry-Paraffin: GSTZ1 Antibody [NBP1-83320] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and leydig cells.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/DATA_SLPI_DPI00_ELISA_792.jpg)
![N/A SLPI [HRP]](https://images.novusbio.com/images2/SLPI_DPI00_ELISA_160.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")