![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach and skeletal muscle tissues. Corresponding PGC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0015.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach and skeletal muscle tissues. Corresponding PGC RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. IHC-F reactivity reported in (PMID: 29925878). |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![PGA5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PGA5 [Unconjugated]")
| Publication using NBP1-91011 | Applications | Species |
|---|---|---|
| Berglund E, Maaskola J, Schultz N et al. Spatial maps of prostate cancer transcriptomes reveal an unexplored landscape of heterogeneity Nat Commun 2018-06-20 [PMID: 29925878] (IHC-Fr, Human) | IHC-Fr | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pepsinogen C/PGC/Progastricsin Antibody (NBP1-91011)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGC |
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody NBP1-91011 (A) shows similar protein distribution across tissues to independent antibody NBP1-91012 (B).](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0014.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex, colon, skeletal muscle and stomach using Anti-PGC antibody NBP1-91011 (A) shows similar protein distribution across tissues to independent antibody NBP1-91012 (B).")
![Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Western-Blot-NBP1-91011-img0013.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in control (vector only transfected HEK293T lysate) and PGC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0019.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach tissue.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Western-Blot-NBP1-91011-img0009.jpg "Western Blot: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Analysis in human stomach tissue.")
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0016.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0017.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human colon shows low positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Pepsinogen-C-PGC-Progastricsin-Antibody-Immunohistochemistry-Paraffin-NBP1-91011-img0018.jpg "Immunohistochemistry-Paraffin: Pepsinogen C/PGC/Progastricsin Antibody [NBP1-91011] - Staining of human colon shows low positivity in glandular cells as expected.")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")