Novus Biologicals products are now on bio-techne.com

Recombinant Human NDUFA3 GST (N-Term) Protein

Name: Recombinant Human NDUFA3 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00004696-P01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

SDS-Page: Recombinant Human NDUFA3 Protein [H00004696-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human NDUFA3 GST (N-Term) Protein Summary

Description	Recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-84 of Human NDUFA3 Source: Wheat Germ (in vitro) Amino Acid Sequence: MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	NDUFA3
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array SDS-Page Western Blot
Theoretical MW	35.7 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NDUFA3 GST (N-Term) Protein

B9
CI-B9
complex I B9 subunit
Complex I-B9
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3 (9kD, B9)
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
NADH-ubiquinone oxidoreductase B9 subunit

Background

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

IL-6 [HRP]

M6000B

(643 Publications)

Species: Mu

Applications: ELISA

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(809 Publications)

Species: Hu

Applications: BA

NDUFA2 Antibody -
BSA Free

NBP2-93743

Species: Hu, Mu, Rt

Applications: ICC/IF, WB

IL-2 [Unconjugated]

202-IL

(4 Reviews)

(374 Publications)

Species: Hu

Applications: BA

B7-1/CD80 Antibody
(37711) [Unconjugated ...

MAB140

Immunohistochemistry B7-1/CD80 Antibody (37711) [Unconjugated]

Dual RNAscope ISH-IHC Compatible B7-1/CD80 Antibody (37711) [Unconjugated]

(25 Publications)

Species: Hu

Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut

BBS9 Antibody

NBP1-88927

(3 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, WB

PLEKHM1 Antibody

NBP2-38449

Species: Hu

Applications: ICC/IF, IHC, IHC-P

CD20 Antibody
(AISB12) - BSA Free

NBP1-43435

Flow Cytometry CD20 Antibody (AISB12) - BSA Free

(3 Publications)

Species: Hu, Mu

Applications: Flow, WB

SPANXB1 Antibody

H00728695-B01P

Species: Hu

Applications: ICC/IF, IP, WB

STT3A Antibody
(4D4)

H00003703-M02

Immunohistochemistry-Paraffin STT3A Antibody (4D4)

(5 Publications)

Species: Hu

Applications: ELISA, IHC, IHC-P, IP, WB

EIF3M Antibody

NBP1-56654

(3 Publications)

Species: Hu

Applications: IHC, IHC-P, WB

IL-1 beta/IL-1F2
[Unconjugated]

201-LB

Bioactivity IL-1 beta/IL-1F2 [Unconjugated]

SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]

(592 Publications)

Species: Hu

Applications: BA

ENPP-3/CD203c
Antibody (NP4D6) - BS ...

NBP1-44643

Immunocytochemistry/ Immunofluorescence ENPP-3/CD203c Antibody (NP4D6) - BSA Free

Species: Hu

Applications: CyTOF-ready, Flow, ICC/IF

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(24 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

IL-4 [Unconjugated]

6507-IL/CF

(3 Publications)

Species: Hu

Applications: BA

CD19 Antibody
(CB19) - BSA Free

NBP2-25196

(1 Review)

(12 Publications)

Species: Hu, Mu

Applications: CyTOF-ready, Flow, ICC/IF, In vitro, WB

gp130/CD130 [HRP]

DGP00

(14 Publications)

Species: Hu

Applications: ELISA

IL-11 [HRP]

D1100

(29 Publications)

Species: Hu

Applications: ELISA

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

Recombinant Human
NDUFA3 GST (N-Term) P ...

H00004696-P01

Species: Hu

Applications: WB, ELISA, MA, PAGE, AP

Publications for NDUFA3 Recombinant Protein (H00004696-P01) (0)

There are no publications for NDUFA3 Recombinant Protein (H00004696-P01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NDUFA3 Recombinant Protein (H00004696-P01) (0)

There are no reviews for NDUFA3 Recombinant Protein (H00004696-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NDUFA3 Recombinant Protein (H00004696-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NDUFA3 Products

Research Areas for NDUFA3 Recombinant Protein (H00004696-P01)

Find related products by research area.

Blogs on NDUFA3

There are no specific blogs for NDUFA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human NDUFA3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

NDUFA3

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human NDUFA3 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human NDUFA3 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human NDUFA3 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for NDUFA3 Recombinant Protein (H00004696-P01) (0)

Reviews for NDUFA3 Recombinant Protein (H00004696-P01) (0)

Product General Protocols

Video Protocols

FAQs for NDUFA3 Recombinant Protein (H00004696-P01) (0)

Additional NDUFA3 Products

Research Areas for NDUFA3 Recombinant Protein (H00004696-P01)

Blogs on NDUFA3

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics