Home » Myosin Heavy Chain 3 » Myosin Heavy Chain 3 Proteins » Myosin Heavy Chain 3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Myosin Heavy Chain 3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Myosin Heavy Chain 3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYH3.

Source: E. coli

Amino Acid Sequence: IEAQNQPFDAKTYCFVVDSKEEYAKGKIKSSQDGKVTVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAML

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MYH3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89707.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin Heavy Chain 3 Recombinant Protein Antigen

  • HEMHC
  • Muscle embryonic myosin heavy chain
  • MYH3
  • MYHC-EMB
  • MYHSE1
  • Myosin Heavy Chain 3
  • Myosin heavy chain, fast skeletal muscle, embryonic
  • myosin, heavy chain 3, skeletal muscle, embryonic
  • myosin, heavy polypeptide 3, skeletal muscle, embryonic
  • myosin, skeletal, heavy chain, embryonic 1
  • myosin-3
  • SMHCE
  • SMHCEMyosin heavy chain 3

Background

Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. Mutations in this gene have been associated with two congenital contracture (arthrogryposis) syndromes, Freeman-Sheldon syndrome and Sheldon-Hall syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MYH8 Antibody -
BSA Free
NBP2-41309
Immunocytochemistry/ Immunofluorescence MYH8 Antibody - BSA Free
Western Blot MYH8 Antibody - BSA Free
Immunohistochemistry MYH8 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
Myosin Heavy Chain
1 Antibody - Azide an ...
NBP2-95223
Western Blot Myosin Heavy Chain 1 Antibody - Azide and BSA Free
Western Blot Myosin Heavy Chain 1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin Myosin Heavy Chain 1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
tropomyosin-2
Antibody - Azide and ...
NBP2-95197
Immunohistochemistry-Paraffin tropomyosin-2 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin tropomyosin-2 Antibody - Azide and BSA Free
Western Blot tropomyosin-2 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Troponin I type 2
(fast skeletal) Antib ...
NBP2-26200
Western Blot Troponin I type 2 (fast skeletal) Antibody
Western Blot Troponin I type 2 (fast skeletal) Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Po, Rt
Applications: PEP-ELISA, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Western Blot MyoD Antibody (5.8A) - BSA Free
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Troponin T Type 3
(fast skeletal) Antib ...
NBP2-26199
Immunohistochemistry-Paraffin Troponin T Type 3 (fast skeletal) Antibody
Western Blot Troponin T Type 3 (fast skeletal) Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(425 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
(1 Review)
(164 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
MYH7 Antibody
(940906) [Unconjugate
MAB9096
Immunohistochemistry MYH7 Antibody (940906) [Unconjugated]
Western Blot MYH7 Antibody (940906) [Unconjugated]
Species: Hu
Applications: IHC, WB
Recombinant Human
TATA binding protein ...
H00006908-Q01
SDS-PAGE Recombinant Human TATA binding protein TBP GST (N-Term) Protein
(5 Publications)
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Myosin heavy chain
2 Antibody - Azide an ...
NBP2-94624
Western Blot Myosin heavy chain 2 Antibody - Azide and BSA Free
Western Blot Myosin heavy chain 2 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Myosin heavy chain 2 Antibody - Azide and BSA Free
Species: Mu, Rt
Applications: ICC/IF, WB
MYH4 Antibody -
BSA Free
NBP3-05634
Western Blot MYH4 Antibody - BSA Free
Western Blot MYH4 Antibody - BSA Free
Immunohistochemistry-Paraffin MYH4 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MYF-5 Antibody
(OTI2G5)
NBP2-44245
Western Blot MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
beta
2-Microglobulin Antib ...
NB500-317
Western Blot beta 2-Microglobulin Antibody (B2M-01) - BSA Free
Flow Cytometry beta 2-Microglobulin Antibody (B2M-01) - BSA Free
ELISA beta 2-Microglobulin Antibody (B2M-01) - BSA Free
(1 Review)
(3 Publications)
Species: Bv(-), Ca(-), Ch(-), Hu, Mu(-), Rb(-)
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA, WB
Myosin Heavy Chain
3 Antibody
NBP1-89707
Immunohistochemistry-Paraffin Myosin Heavy Chain 3 Antibody
Immunohistochemistry-Paraffin Myosin Heavy Chain 3 Antibody
Immunohistochemistry-Paraffin Myosin Heavy Chain 3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
Actin Antibody
(mAbGEa)
NB100-74340
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
Western Blot Actin Antibody (mAbGEa)
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
(8 Reviews)
(33 Publications)
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Myosin Heavy Chain
3 Recombinant Protein ...
NBP1-89707PEP
Myosin Heavy Chain 3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP) (0)

There are no publications for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP) (0)

There are no reviews for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin Heavy Chain 3 Products

Research Areas for Myosin Heavy Chain 3 Recombinant Protein Antigen (NBP1-89707PEP)

Find related products by research area.

Blogs on Myosin Heavy Chain 3

There are no specific blogs for Myosin Heavy Chain 3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin Heavy Chain 3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MYH3