Novus Biologicals products are now on bio-techne.com

MAP4K5 Recombinant Protein Antigen

Name: MAP4K5 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-83385PEP
Price: 289 USD

Images

There are currently no images for MAP4K5 Protein (NBP1-83385PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

MAP4K5 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MAP4K5. Source: E. coli Amino Acid Sequence: YPEDNFPDEEKASTIKHCPDSESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKKDKRDFPKPA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MAP4K5
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83385. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MAP4K5 Recombinant Protein Antigen

EC 2.7.11
EC 2.7.11.1
GCKR
germinal center kinase-related
KHS1
KHSMEKKK 5
Kinase homologous to SPS1/STE20
MAP4K5
MAPK/ERK kinase kinase kinase 5
MAPKKKK5
MEK kinase kinase 5
mitogen-activated protein kinase kinase kinase kinase 5

Background

MAP4K5 encodes a member of the serine/threonine protein kinase family, that is highly similar to yeast SPS1/STE20 kinase. Yeast SPS1/STE20 functions near the beginning of the MAP kinase signal cascades that is essential for yeast pheromone response. This kinase was shown to activate Jun kinase in mammalian cells, which suggested a role in stress response. Two alternatively spliced transcript variants encoding the same protein have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Glucokinase/GCK
Antibody (OTI3E3)

NBP1-47778

Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Insulin Antibody
(182410) [Unconjugate ...

MAB1417

Immunohistochemistry Insulin Antibody (182410) [Unconjugated]

(25 Publications)

Species: Bv, Hu, Mu

Applications: CyTOF-ready, ICC, IHC, ICFlow

MAP4K2 Antibody -
BSA Free

NBP1-88584

Immunohistochemistry-Paraffin MAP4K2 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Apolipoprotein A5
Antibody (1G5G9)

NB400-139

Flow Cytometry Apolipoprotein A5 Antibody (1G5G9)

(3 Publications)

Species: Ha, Hu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

JNK1 Antibody
(228601) [Unconjugate

MAB17761

Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu, Mu, Rt

Applications: ICC, WB

Glycerol Kinase
Antibody (8S4T8)

NBP3-15687

Western Blot Glycerol Kinase Antibody (8S4T8)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(824 Publications)

Species: Hu

Applications: BA

Lipoprotein
Lipase/LPL Antibody [ ...

AF7197

Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]

Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]

(12 Publications)

Species: Hu, Mu

Applications: ICC, IHC, WB

Melatonin Receptor
1B Antibody - BSA Fre ...

NLS932

Western Blot Melatonin Receptor 1B Antibody - BSA Free

Immunohistochemistry Melatonin Receptor 1B Antibody - BSA Free

(1 Review)

(13 Publications)

Species: Ch, Hu, Mu, Rt

Applications: IHC, IHC-Fr, IHC-P, KD, WB

C-Reactive
Protein/CRP [Biotin]

DY1707

(71 Publications)

Species: Hu

Applications: ELISA

TRAF-2 Antibody

NB100-56173

Immunohistochemistry-Paraffin TRAF-2 Antibody

(4 Publications)

Species: Hu

Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

TCF7L2 Antibody
(3A4) - Azide and BSA ...

H00006934-M06

Immunocytochemistry/ Immunofluorescence TCF7L2 Antibody (3A4) - Azide and BSA Free

Immunohistochemistry-Paraffin TCF7L2 Antibody (3A4) - Azide and BSA Free

(1 Review)

(2 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Plastin L Antibody
- BSA Free

NBP2-19860

Western Blot Plastin L Antibody - BSA Free

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

JNK2 Antibody
(252320) [Unconjugate

MAB1846

Knockout Validated JNK2 Antibody (252320) [Unconjugated]

Immunocytochemistry JNK2 Antibody (252320) [Unconjugated]

(2 Reviews)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ICC, KO, WB

FADS1 Antibody
(7A10)

NBP3-26590

Immunocytochemistry/ Immunofluorescence FADS1 Antibody (7A10)

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC, WB

ASK1 Antibody

NB100-56077

Species: Hu

Applications: IHC, IHC-P, IP, WB

HNF-4 alpha/NR2A1
Antibody - BSA Free

NBP1-89679

Western Blot HNF-4 alpha/NR2A1 Antibody - BSA Free

(1 Review)

(5 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

Apolipoprotein
B/ApoB Antibody (3697 ...

MAB4124

Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]

Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]

(7 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

G6PC2 Antibody

NBP3-12306

Species: Hu, Mu, Pm, Rt

Applications: ELISA, IHC, IHC-P, IP, WB

c-jun [p Ser63]
Antibody (1018Y) [Unc ...

MAB8930

Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]

(1 Review)

(3 Publications)

Species: Hu

Applications: ICC, Simple Western, WB

Publications for MAP4K5 Protein (NBP1-83385PEP) (0)

There are no publications for MAP4K5 Protein (NBP1-83385PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP4K5 Protein (NBP1-83385PEP) (0)

There are no reviews for MAP4K5 Protein (NBP1-83385PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MAP4K5 Protein (NBP1-83385PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAP4K5 Products

Research Areas for MAP4K5 Protein (NBP1-83385PEP)

Find related products by research area.

Protein Kinase

Blogs on MAP4K5

There are no specific blogs for MAP4K5, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MAP4K5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MAP4K5

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MAP4K5 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MAP4K5 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MAP4K5 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MAP4K5 Protein (NBP1-83385PEP) (0)

Reviews for MAP4K5 Protein (NBP1-83385PEP) (0)

FAQs for MAP4K5 Protein (NBP1-83385PEP) (0)

Additional MAP4K5 Products

Research Areas for MAP4K5 Protein (NBP1-83385PEP)

Blogs on MAP4K5

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics