Home » LAP (TGF-beta 1) » LAP (TGF-beta 1) Proteins » LAP (TGF-beta 1) Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

LAP (TGF-beta 1) Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

LAP (TGF-beta 1) Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAP (TGF-beta 1)

Source: E.coli

Amino Acid Sequence: EWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TGFB1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21360. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for LAP (TGF-beta 1) Recombinant Protein Antigen

  • CED
  • DPD1
  • LAP (TGFbeta 1)
  • LAP (TGF-beta 1)
  • LAP
  • TGFB
  • TGFB1
  • TGFbeta
  • transforming growth factor beta 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(656 Publications)
Species: Mu
Applications: ELISA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(299 Publications)
Species: Mu
Applications: ELISA
Smad2/3 Antibody
[Unconjugated]
AF3797
Western Blot Smad2/3 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]
Immunocytochemistry Smad2/3 Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
Smad3 Antibody
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody
Western Blot Smad3 Antibody
Immunohistochemistry-Paraffin Smad3 Antibody
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CTGF/CCN2 Antibody
[Unconjugated] - C-te ...
AF660
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus
(7 Publications)
Species: Hu
Applications: IHC
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(681 Publications)
Species: Hu
Applications: ELISA
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(546 Publications)
Species: Hu
Applications: BA
LAP3 Antibody
NBP1-82847
Immunohistochemistry-Paraffin LAP3 Antibody
Immunohistochemistry-Paraffin LAP3 Antibody
Immunohistochemistry-Paraffin LAP3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(834 Publications)
Species: Hu
Applications: BA
Smad4 Antibody
[Unconjugated]
AF2097
Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]
Western Blot Smad4 Antibody [Unconjugated]
Immunocytochemistry Smad4 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ChIP, ICC, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
Smad7 Antibody
(293039) [Unconjugate
MAB2029
Western Blot Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
Immunohistochemistry Smad7 Antibody (293039) [Unconjugated]
(1 Review)
(59 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
LAP (TGF-beta 1)
Recombinant Protein A ...
NBP3-21360PEP
LAP (TGF-beta 1) Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP) (0)

There are no publications for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP) (0)

There are no reviews for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional LAP (TGF-beta 1) Products

Research Areas for LAP (TGF-beta 1) Recombinant Protein Antigen (NBP3-21360PEP)

Find related products by research area.

Blogs on LAP (TGF-beta 1)

There are no specific blogs for LAP (TGF-beta 1), but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of K562 human chronic myelogenous leukemia cell line and A549 human lung carcinoma cell line, loaded at 0.2 mg/mL. A specific band was detected for LAP (TGF-beta 1) at approximately 61 kDa (as indicated) using 20 µg/mL of Goat Anti-Human LAP (TGF-beta 1) Antigen Affinity-purified Polyclonal Antibody (Catalog #AF-246-NA) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
LAP (TGF-beta 1) Antibody [Unconjugated]
AF-246-NA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our LAP (TGF-beta 1) Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TGFB1