Home » KLRC4 » KLRC4 Antibodies » KLRC4 Antibody - Azide and BSA Free
Novus Biologicals products are now on bio-techne.com

KLRC4 Antibody - Azide and BSA Free

 Submit a Review

Images

 
(
Enlarge)
Western Blot: KLRC4 Antibody [NBP3-04739] - Analysis of extracts of various cell lines, using KLRC4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Western Blot: KLRC4 Antibody [NBP3-04739] - Analysis of extracts of various cell lines, using KLRC4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: ...read more
Immunocytochemistry/ Immunofluorescence: KLRC4 Antibody [NBP3-04739] - Analysis of Jurkat cells using KLRC4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry: KLRC4 Antibody [NBP3-04739] - Analysis of mouse spleen using KLRC4 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
Azide and BSA Free
NBP3-04739-20ul
Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KLRC4 Antibody - Azide and BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-55 of human KLRC4 (NP_038459.1). MNKQRGTYSEVSLAQDPKRQQRKLKGNKISISGTKQEIFQVELNLQNASSDHQGN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLRC4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry
  • Western Blot 1:500 - 1:2000
Theoretical MW
18 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for KLRC4 Antibody - Azide and BSA Free

  • D12S2489E
  • FLJ17759
  • killer cell lectin-like receptor subfamily C, member 4
  • KLRC4
  • natual killer cell group 2-F
  • NK cell receptor F
  • NKG2-F type II integral membrane protein
  • NKG2F
  • NKG2-F
  • NKG2-F-activating NK receptor
  • NKG2FFLJ78582

Background

Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC4 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. The 3' end of the KLRC4 transcript includes the first non-coding exon found at the 5' end of the adjacent D12S2489E gene transcript. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NKG2A/CD159a/KLRC1
Antibody (131411) [Un ...
MAB1059
Flow Cytometry NKG2A/CD159a/KLRC1 Antibody (131411) [Unconjugated]
Flow Cytometry NKG2A/CD159a/KLRC1 Antibody (131411) [Unconjugated]
(17 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
NKG2C/CD159c/KLRC2
Antibody (134591) [Un ...
MAB138
Flow Cytometry NKG2C/CD159c/KLRC2 Antibody (134591) [Unconjugated]
(22 Publications)
Species: Hu
Applications: CyTOF-reported, Flow
NKG2D/CD314
Antibody (149810) [Un ...
MAB139
Flow Cytometry NKG2D/CD314 Antibody (149810) [Unconjugated]
Flow Cytometry NKG2D/CD314 Antibody (149810) [Unconjugated]
Flow Cytometry NKG2D/CD314 Antibody (149810) [Unconjugated]
(1 Review)
(101 Publications)
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
CD94 Antibody
(131412) [Unconjugate
MAB1058
CD94 Antibody (131412) [Unconjugated]
(4 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow
NKG2H Antibody
(633810)
MAB6549
Western Blot NKG2H Antibody (633810)
Species: Hu
Applications: WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CD161 Antibody
(14F1F11) - BSA Free
NBP2-14845
Immunohistochemistry-Paraffin CD161 Antibody (14F1F11) - BSA Free
Immunohistochemistry-Paraffin CD161 Antibody (14F1F11) - BSA Free
Western Blot CD161 Antibody (14F1F11) - BSA Free
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IL-15
[Unconjugated]
247-ILB
SEC-MALS IL-15 [Unconjugated]
(165 Publications)
Species: Hu
Applications: BA
DAP12 Antibody
NBP1-85313
Immunohistochemistry-Paraffin DAP12 Antibody
Western Blot DAP12 Antibody
Immunohistochemistry-Paraffin DAP12 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GliS2 Antibody
NBP2-84979
Immunohistochemistry GliS2 Antibody
Western Blot GliS2 Antibody
Western Blot GliS2 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
DAP1 Antibody -
BSA Free
NBP2-92897
Immunocytochemistry/ Immunofluorescence DAP1 Antibody - BSA Free
Western Blot DAP1 Antibody - BSA Free
Immunohistochemistry-Paraffin DAP1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Acetylcholinesterase/A
NB100-1519
Flow Cytometry Acetylcholinesterase/ACHE Antibody
Western Blot Acetylcholinesterase/ACHE Antibody
Immunocytochemistry/ Immunofluorescence Acetylcholinesterase/ACHE Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
MYLIP Antibody
(OTI3A2)
NBP2-46069
Western Blot MYLIP Antibody (OTI3A2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB

NK3R/TACR3/Neurokinin ...
NB300-102
NK3R/TACR3/Neurokinin B Receptor Antibody
(37 Publications)
Species: Gp, Hu(-), Mu, Rt, Sh
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB (-)
MARCH8 Antibody
NBP1-85540
Western Blot MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Immunohistochemistry-Paraffin MARCH8 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for KLRC4 Antibody (NBP3-04739) (0)

There are no publications for KLRC4 Antibody (NBP3-04739).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KLRC4 Antibody (NBP3-04739) (0)

There are no reviews for KLRC4 Antibody (NBP3-04739). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KLRC4 Antibody (NBP3-04739) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KLRC4 Products

Research Areas for KLRC4 Antibody (NBP3-04739)

Find related products by research area.

Blogs on KLRC4.

Check out the latest blog posts on KLRC4.
Harnessing Natural Killer Cell Activity for Anti-Tumor Immunotherapy
By Victoria Osinski, PhDWhat’s “Natural” About Natural Killer (NK) Cells?For immunologists, the term cytotoxicity often conjures up images of an army of antigen specific CD8+ T cells deploying to ...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KLRC4 Antibody - Azide and BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol KLRC4