Home » IRF5 » IRF5 Proteins » IRF5 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IRF5 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IRF5 Recombinant Protein Antigen (NBP3-21400PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

IRF5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IRF5

Source: E.coli

Amino Acid Sequence: KPREKKLITVQVVPVAARLLLEMFSGELSWSADSIRLQISNPDLKDRMVEQFKE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IRF5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21400. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IRF5 Recombinant Protein Antigen

  • IBD14
  • interferon regulatory factor 5
  • IRF5
  • IRF-5
  • SLEB10

Background

IRF5 encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Alternative splice variants encoding different isoforms exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

STAT4 [p Tyr693]
Antibody [Unconjugate ...
AF4319
Western Blot STAT4 [p Tyr693] Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: WB
IRF7 Antibody
(SC0617)
NBP2-67634
Immunocytochemistry/ Immunofluorescence IRF7 Antibody (SC0617)
Immunocytochemistry/ Immunofluorescence IRF7 Antibody (SC0617)
Immunohistochemistry-Paraffin IRF7 Antibody (SC0617)
(1 Publication)
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
MuRF1/TRIM63
Antibody [Unconjugate
AF5366
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
Simple Western MuRF1/TRIM63 Antibody [Unconjugated]
Western Blot MuRF1/TRIM63 Antibody [Unconjugated]
(26 Publications)
Species: Hu, Mu, Rt
Applications: Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(676 Publications)
Species: Mu
Applications: ELISA
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(159 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
IRF3 Antibody
(SD2062)
NBP2-67741
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunohistochemistry-Paraffin IRF3 Antibody (SD2062)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Lyp/PTPN22
Antibody [Unconjugate
AF3428
Western Blot Lyp/PTPN22 Antibody [Unconjugated]
Simple Western Lyp/PTPN22 Antibody [Unconjugated]
Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(824 Publications)
Species: Hu
Applications: BA
TLR7 Antibody -
BSA Free
NBP2-24906
Immunocytochemistry/ Immunofluorescence TLR7 Antibody - BSA Free
Immunohistochemistry-Frozen TLR7 Antibody - BSA Free
Immunohistochemistry TLR7 Antibody - BSA Free
(4 Reviews)
(82 Publications)
Species: Hu, Mu, Rt
Applications: BA, DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, Simple Western, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
MyD88 Inhibitor
Peptide Set
NBP2-29328
MyD88 Inhibitor Peptide Set
(3 Reviews)
(100 Publications)
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Blk Antibody
(7A12) - Azide and BS ...
H00000640-M02
ELISA Blk Antibody (7A12) - Azide and BSA Free
Western Blot Blk Antibody (7A12) - Azide and BSA Free
Western Blot Blk Antibody (7A12) - Azide and BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
Tyk2 Antibody
(307214) [Unconjugate
MAB3427
Western Blot Tyk2 Antibody (307214) [Unconjugated]
(1 Review)
Species: Hu
Applications: WB
TLR4 Antibody
(76B357.1) - BSA Free
NB100-56566
Dual RNAscope ISH-IHC TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
Immunohistochemistry TLR4 Antibody (76B357.1) - BSA Free
(5 Reviews)
(145 Publications)
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
TRAF-6 Inhibitor
Peptide Set
NBP2-26506
Unknown TRAF-6 Inhibitor Peptide Set
(19 Publications)
Species: Hu, Mu, Rt
Applications: B/N, In vitro
BANK1 Antibody -
BSA Free
NBP1-88714
Immunohistochemistry-Paraffin BANK1 Antibody - BSA Free
Immunohistochemistry-Paraffin BANK1 Antibody - BSA Free
Immunohistochemistry-Paraffin BANK1 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CD11b Antibody -
BSA Free
NB110-89474
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence CD11b Antibody - BSA Free
(12 Reviews)
(128 Publications)
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Simple Western, Single-Cell Western, WB
IRF5 Recombinant
Protein Antigen
NBP3-21400PEP
IRF5 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IRF5 Recombinant Protein Antigen (NBP3-21400PEP) (0)

There are no publications for IRF5 Recombinant Protein Antigen (NBP3-21400PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF5 Recombinant Protein Antigen (NBP3-21400PEP) (0)

There are no reviews for IRF5 Recombinant Protein Antigen (NBP3-21400PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IRF5 Recombinant Protein Antigen (NBP3-21400PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IRF5 Products

Research Areas for IRF5 Recombinant Protein Antigen (NBP3-21400PEP)

Find related products by research area.

Blogs on IRF5

There are no specific blogs for IRF5, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IRF5 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IRF5