![Western Blot: Glycogen Synthase Antibody [NBP2-34071] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/Glycogen-Synthase-Antibody-Western-Blot-NBP2-34071-img0003.jpg "Western Blot: Glycogen Synthase Antibody [NBP2-34071] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSLSRHSSPHQSEDEEDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLSTPSE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GYS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Glycogen Synthase Antibody (NBP2-34071)Find related products by research area.
|
|
AKT Antibody Assays: A Complex Area with an Easy Solution We at Novus Biologicals place a lot of emphasis on the kinase signaling pathways. Kinases, or phosphotransferase enzymes play a key role in phosphorylation signaling. Over 500 human protein kinases have so far been discovered. They play essential role... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Glycogen Synthase Antibody [NBP2-34071] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.](http://images.novusbio.com/fullsize/Glycogen-Synthase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-34071-img0006.jpg "Immunocytochemistry/Immunofluorescence: Glycogen Synthase Antibody [NBP2-34071] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & microtubules.")
![Immunohistochemistry-Paraffin: Glycogen Synthase Antibody [NBP2-34071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/Glycogen-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP2-34071-img0005.jpg "Immunohistochemistry-Paraffin: Glycogen Synthase Antibody [NBP2-34071] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")