![Western Blot: Glutamine Synthetase Antibody [NBP3-03471] - Western blot analysis of extracts from normal (control) and Glutamine Synthetase knockout (KO) 293T cells, using Glutamine Synthetase antibody (NBP3-03471) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Western-Blot-NBP3-03471-img0007.jpg "Western Blot: Glutamine Synthetase Antibody [NBP3-03471] - Western blot analysis of extracts from normal (control) and Glutamine Synthetase knockout (KO) 293T cells, using Glutamine Synthetase antibody (NBP3-03471) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-373 of human Glutamine Synthetase (NP_002056.2). MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLUL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 42 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western IA-2/PTPRN Antibody (815811) [Unconjugated]](https://images.novusbio.com/images2/IA2_MAB7906_Simple_Western_17659.jpg)
![Immunohistochemistry IA-2/PTPRN Antibody (815811) [Unconjugated]](https://images.novusbio.com/images2/IA2_MAB7906_Immunohistochemistry_12951.jpg)
![Western Blot IA-2/PTPRN Antibody (815811) [Unconjugated]](https://images.novusbio.com/images2/IA2_MAB7906_Western_Blot_12957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Glutamine Synthetase Antibody (NBP3-03471)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GLUL |
![Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03471-img0003.jpg "Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded rat liver using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunohistochemistry-Paraffin-NBP3-03471-img0006.jpg "Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded rat liver using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: Glutamine Synthetase Antibody [NBP3-03471] - Western blot analysis of extracts of various cell lines, using Glutamine Synthetase antibody (NBP3-03471) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Glutamine Synthetase Antibody-Western Blot-NBP3-03471-img0008.jpg "Western Blot: Glutamine Synthetase Antibody [NBP3-03471] - Western blot analysis of extracts of various cell lines, using Glutamine Synthetase antibody (NBP3-03471) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
![Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of HeLa cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03471-img0001.jpg "Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of HeLa cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunocytochemistry-Immunofluorescence-NBP3-03471-img0002.jpg "Immunocytochemistry/Immunofluorescence: Glutamine Synthetase Antibody [NBP3-03471] - Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded human esophageal using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunohistochemistry-Paraffin-NBP3-03471-img0004.jpg "Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded human esophageal using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Glutamine-Synthetase-Antibody-Immunohistochemistry-Paraffin-NBP3-03471-img0005.jpg "Immunohistochemistry-Paraffin: Glutamine Synthetase Antibody [NBP3-03471] - Immunohistochemistry of paraffin-embedded human liver using [KO Validated] Glutamine Synthetase Rabbit pAb (NBP3-03471) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Immunohistochemistry_6730.jpg)
![Western Blot GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Western_Blot_19950.jpg)
![Simple Western GAD1/GAD67 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD1_AF2086_Simple_Western_20168.jpg)
![Immunohistochemistry GAD2/GAD65 Antibody [Unconjugated]](https://images.novusbio.com/images2/GAD2_AF2247_Immunohistochemistry_20053.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_729.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/DATA_Kallikrein_3_DKK300_ELISA_730.jpg)
![N/A Kallikrein 3/PSA [HRP]](https://images.novusbio.com/images2/Kallikrein_3_DKK300_ELISA_124.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")