Home » ENDOGL1 » ENDOGL1 Proteins » ENDOGL1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ENDOGL1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

ENDOGL1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ENDOGL1.

Source: E. coli

Amino Acid Sequence: VIGEDNVAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGFQPQLTEFQVSLQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EXOG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62597.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ENDOGL1 Recombinant Protein Antigen

  • EC 3.1.30
  • EC 3.1.30.-
  • Endo G-like 1
  • endo/exonuclease (5'-3'), endonuclease G-like
  • ENDOGL1mitochondrial
  • ENDOGL2
  • Endonuclease G-like 1MGC125945
  • ENGLA
  • ENGLB
  • ENGLMGC125944

Background

The ENDOGL1 gene encodes an endo/exonuclease with 5'-3' exonuclease activity. The encoded enzyme catalyzes the hydrolysis of ester linkages at the 5' end of a nucleic acid chain. This enzyme is localized to the mitochondria and may play a role in programmed cell

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
IRF1 Antibody
AF4715
Western Blot IRF1 Antibody
(1 Review)
(2 Publications)
Species: Mu
Applications: WB
Neprilysin-2/MMEL1
Antibody
AF2340
Neprilysin-2/MMEL1 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
Integrin alpha
2/CD49b Antibody (HAS ...
MAB1233
Immunocytochemistry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
Flow Cytometry Integrin alpha 2/CD49b Antibody (HAS3) [Unconjugated]
(7 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
BRD2 Antibody
NBP1-30475
Immunohistochemistry-Paraffin BRD2 Antibody
Immunocytochemistry/ Immunofluorescence BRD2 Antibody
Immunoprecipitation BRD2 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
ZBTB8OS Antibody
NBP2-30455
Immunohistochemistry ZBTB8OS Antibody
Immunocytochemistry/ Immunofluorescence ZBTB8OS Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Endo G Antibody -
BSA Free
NBP1-76657
Immunofluorescence Endo G Antibody - BSA Free
Immunohistochemistry Endo G Antibody - BSA Free
Western Blot Endo G Antibody - BSA Free
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Muscleblind-like 1
Antibody (3E7)
H00004154-M02
Western Blot Muscleblind-like 1 Antibody (3E7)
ELISA Muscleblind-like 1 Antibody (3E7)
Immunocytochemistry/ Immunofluorescence Muscleblind-like 1 Antibody (3E7)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Actin Antibody
(mAbGEa)
NB100-74340
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
Western Blot Actin Antibody (mAbGEa)
Immunocytochemistry/ Immunofluorescence Actin Antibody (mAbGEa)
(8 Reviews)
(33 Publications)
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Osteocalcin
Antibody (190125)
MAB1419
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Intracellular Staining by Flow Cytometry Osteocalcin Antibody (190125)
Immunocytochemistry Osteocalcin Antibody (190125)
(3 Reviews)
(54 Publications)
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
GEN1 Antibody
NBP2-30783
Western Blot GEN1 Antibody
Immunocytochemistry/ Immunofluorescence GEN1 Antibody
Species: Hu
Applications: ICC/IF, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(66 Publications)
Species: Hu
Applications: ELISA
Doublecortin
Antibody
NBP1-72042
Western Blot Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
Immunocytochemistry/ Immunofluorescence Doublecortin Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB

Publications for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no publications for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no reviews for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ENDOGL1 Recombinant Protein Antigen (NBP2-62597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ENDOGL1 Products

Blogs on ENDOGL1

There are no specific blogs for ENDOGL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of human serum, loaded at 1:25000. A specific band was detected for Albumin at approximately 64 kDa (as indicated) using 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) . This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Albumin Antibody (188835) [Unconjugated] - Serum
MAB1455
Immunohistochemistry-Frozen: CD4 Antibody [NBP1-19371] - Staining in mouse liver tissue.
CD4 Antibody - BSA Free
NBP1-19371

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ENDOGL1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol EXOG