![Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371] - Western blot analysis of extracts of various cell lines, using DDX5 Rabbit mAb (NBP3-15371) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Western-Blot-NBP3-15371-img0007.jpg "Western Blot: DDX5 Antibody (1K6X10) [NBP3-15371] - Western blot analysis of extracts of various cell lines, using DDX5 Rabbit mAb (NBP3-15371) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP |
| Clone | 1K6X10 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human DDX5 (P17844). MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | DDX5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Western_Blot_5487.jpg)
![Immunohistochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunohistochemistry_19615.jpg)
![Immunocytochemistry DDX17 Antibody [Unconjugated]](https://images.novusbio.com/images2/DDX17_AF4530_Immunocytochemistry__Immunofluorescence_20569.jpg)
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DDX5 |
![Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of NIH-3T3 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunocytochemistry-Immunofluorescence-NBP3-15371-img0006.jpg "Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of NIH-3T3 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunohistochemistry-Paraffin-NBP3-15371-img0003.jpg "Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded mouse spinal cord using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of C6 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunocytochemistry-Immunofluorescence-NBP3-15371-img0004.jpg "Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of C6 cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of HeLa cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunocytochemistry-Immunofluorescence-NBP3-15371-img0005.jpg "Immunocytochemistry/Immunofluorescence: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunofluorescence analysis of HeLa cells using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded rat ovary using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunohistochemistry-Paraffin-NBP3-15371-img0001.jpg "Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded rat ovary using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded human esophageal using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunohistochemistry-Paraffin-NBP3-15371-img0002.jpg "Immunohistochemistry-Paraffin: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunohistochemistry of paraffin-embedded human esophageal using DDX5 Rabbit mAb (NBP3-15371) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunoprecipitation analysis of 600ug extracts of Mouse testis using 3ug DDX5 antibody (NBP3-15371). Western blot was performed from the immunoprecipitate using DDX5 (NBP3-15371) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/DDX5-Antibody-1K6X10-Immunoprecipitation-NBP3-15371-img0008.jpg "Immunoprecipitation: DDX5 Antibody (1K6X10) [NBP3-15371] - Immunoprecipitation analysis of 600ug extracts of Mouse testis using 3ug DDX5 antibody (NBP3-15371). Western blot was performed from the immunoprecipitate using DDX5 (NBP3-15371) at a dilition of 1:1000.")
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_815.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/DATA_TNF_RI_DRT100_ELISA_816.jpg)
![N/A TNF RI/TNFRSF1A [HRP]](https://images.novusbio.com/images2/TNF_RI_DRT100_ELISA_175.jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Immunohistochemistry CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD109_AF4385_Immunohistochemistry_6832.jpg)
![Flow Cytometry CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD109_AF4385_Flow_Cytometry_8246.jpg)
![Western Blot CD109 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4385_human-cd109-affinity-purified-polyclonal-ab-western-blot-2562021132617.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")