![Immunocytochemistry/ Immunofluorescence: DAZL Antibody [NBP3-35406] - Immunofluorescence analysis of paraffin-embedded mouse testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35406_rabbit-dazl-pab-1012202411592828.jpg "Immunocytochemistry/ Immunofluorescence: DAZL Antibody [NBP3-35406] - Immunofluorescence analysis of paraffin-embedded mouse testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 200-250 of human DAZL (NP_001342.2). Sequence: RSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | DAZL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | DAZL |
![Immunohistochemistry: DAZL Antibody [NBP3-35406] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35406_rabbit-dazl-pab-1012202411552865.jpg "Immunohistochemistry: DAZL Antibody [NBP3-35406] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: DAZL Antibody [NBP3-35406] - Western blot analysis of various lysates using DAZL Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-35406_rabbit-dazl-pab-10122024121060.jpg "Western Blot: DAZL Antibody [NBP3-35406] - Western blot analysis of various lysates using DAZL Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![Immunohistochemistry: DAZL Antibody [NBP3-35406] - Immunohistochemistry analysis of paraffin-embedded Rat testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35406_rabbit-dazl-pab-1012202411545588.jpg "Immunohistochemistry: DAZL Antibody [NBP3-35406] - Immunohistochemistry analysis of paraffin-embedded Rat testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: DAZL Antibody [NBP3-35406] - Immunofluorescence analysis of paraffin-embedded rat testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35406_rabbit-dazl-pab-101220241243931.jpg "Immunocytochemistry/ Immunofluorescence: DAZL Antibody [NBP3-35406] - Immunofluorescence analysis of paraffin-embedded rat testis using DAZL Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Chromatin_Immunoprecipitation_11222.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6478.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6636.jpg)
![Bioactivity GDF-9 [Unconjugated]](https://images.novusbio.com/images2/GDF9_739G9_1210.jpg)
![Immunohistochemistry Stella/Dppa3 Antibody [Unconjugated]](https://images.novusbio.com/images2/Stella_AF2566_Immunohistochemistry_24131.jpg)
![Bioactivity GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212GD_2846.jpg)
![SDS-PAGE GDNF [Unconjugated]](https://images.novusbio.com/images2/GDNF_212-GD_62.jpg)
![SEC-MALS GDNF [Unconjugated]](https://images.novusbio.com/images/212-gd_recombinant-human-gdnf-protein-sec-mals-25202393740..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")