![Western Blot: STRA8 Antibody [NBP1-98492] - Human Lung lysate. Antibody at 1.0 ug/mL.](http://images.novusbio.com/fullsize/STRA8-Antibody-Western-Blot-NBP1-98492-img0002.jpg "Western Blot: STRA8 Antibody [NBP1-98492] - Human Lung lysate. Antibody at 1.0 ug/mL.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen for this antibody is STRA8 - C-terminal region (NP_872295). Peptide sequence PEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDED. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | STRA8 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | STRA8 Antibody validated for ICC from a verified customer review. STRA8 Antibody validated for KO from a verified customer review. |
|
| Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 08/05/2020 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Mouse | 11/11/2019 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
ICC | Mouse | 10/09/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 08/05/2020 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 11/11/2019 |
||
| Application: | WB | |
| Species: | Mouse |
| Verified Customer 10/09/2019 |
||
| Application: | ICC | |
| Species: | Mouse |
![Immunocytochemistry: STRA8 Antibody [NBP1-98492] - Adult mouse testis. ICC image submitted by a verified customer review.](http://images.novusbio.com/fullsize/STRA8-Antibody-Immunocytochemistry-NBP1-98492-img0004.jpg "Immunocytochemistry: STRA8 Antibody [NBP1-98492] - Adult mouse testis. ICC image submitted by a verified customer review.")
![Western Blot: STRA8 Antibody [NBP1-98492] - STRA8ko and wt protein to test stra8 protein level in mouse germ cells. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize/STRA8-Antibody-Western-Blot-NBP1-98492-img0005.jpg "Western Blot: STRA8 Antibody [NBP1-98492] - STRA8ko and wt protein to test stra8 protein level in mouse germ cells. WB image submitted by a verified customer review.")
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![Western Blot VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Western_Blot_16711.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images2/VASA_AF2030_Immunohistochemistry_7144.jpg)
![Immunohistochemistry VASA Antibody [Unconjugated]](https://images.novusbio.com/images/af2030_human-vasa-affinity-purified-polyclonal-ab-4120241239493.jpg)
![Chromatin Immunoprecipitation (ChIP) Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Chromatin_Immunoprecipitation_11222.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6478.jpg)
![Immunocytochemistry Nanog Antibody [Unconjugated]](https://images.novusbio.com/images2/Nanog_AF1997_Immunocytochemistry_6636.jpg)
![LIF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LIF [Unconjugated]")
![Bioactivity FGF-9 [Unconjugated]](https://images.novusbio.com/images/protein/273-f9_recombinant-human-fgf-9-protein-bioactivity-2411202075619.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
