![Immunocytochemistry/Immunofluorescence: CPT1C Antibody [NBP2-92133] - Immunofluorescence analysis of L929 cells using CPT1C antibody (NBP2-92133) at dilution of 1:100. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/CPT1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-92133-img0002.jpg "Immunocytochemistry/Immunofluorescence: CPT1C Antibody [NBP2-92133] - Immunofluorescence analysis of L929 cells using CPT1C antibody (NBP2-92133) at dilution of 1:100. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 270-400 of human CPT1C (NP_001129524.1). LYRHRLNRQEIPPTLLMGMRPLCSAQYEKIFNTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSPACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPT1C |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for CPT1C Antibody (NBP2-92133)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CPT1C |
![Western Blot: CPT1C Antibody [NBP2-92133] - analysis of various lysates, using CPT1C Rabbit pAb at 1:7000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit Exposure time: 180s.](http://images.novusbio.com/fullsize/nbp2-92133_rabbit-polyclonal-cpt1c-antibody-western-blot-222202413728..jpg "Western Blot: CPT1C Antibody [NBP2-92133] - analysis of various lysates, using CPT1C Rabbit pAb at 1:7000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit Exposure time: 180s.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Western_Blot_5219.jpg)
![Simple Western AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Simple_Western_16678.jpg)
![Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_alpha_2_AF2850_Immunocytochemistry__Immunofluorescence_19686.jpg)
![Western Blot AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images2/AMPK_beta_1_AF2854_Western_Blot_5220.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023124938.jpg)
![Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2854_human-mouse-rat-ampk-beta-1-affinity-purified-polyclonal-ab-immunohistochemistry-252023125022.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")