![Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color](http://images.novusbio.com/fullsize/CPT1B-Antibody-Western-Blot-NBP1-59576-img0007.jpg "Western Blot: CPT1B Antibody [NBP1-59576] - Sample Type : 1: 45ug human capan1 cell lysate Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-rabbit HRP Secondary Antibody Dilution : 1:5000 Color")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to CPT1B(carnitine palmitoyltransferase 1B (muscle)) The peptide sequence was selected from the middle region of CPT1B. Peptide sequence DLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAA. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CPT1B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 88 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for CPT1B Antibody (NBP1-59576)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200](http://images.novusbio.com/fullsize/CPT1B-Antibody-Immunohistochemistry-NBP1-59576-img0004.jpg "Immunohistochemistry: CPT1B Antibody [NBP1-59576] - searcher: Dr. Pankaj Kumar Singh, UNMC, Omaha, NE Application: IHC Species+tissue/cell type:Species+tissue/cell type: Human Capan1 cells Primary antibody dilution: 1:300 Secondary antibody: Anti-rabbit Alexa Fluor 488 Secondary antibody dilution:1:200")
![Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.](http://images.novusbio.com/fullsize/CPT1B-Antibody-Western-Blot-NBP1-59576-img0003.jpg "Western Blot: CPT1B Antibody [NBP1-59576] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.")
![Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml](http://images.novusbio.com/fullsize/CPT1B-Antibody-Western-Blot-NBP1-59576-img0006.jpg "Western Blot: CPT1B Antibody [NBP1-59576] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/Chymase_MAB4099_Western_Blot_21236.jpg)
![ELISA Chymase/CMA1/Mast Cell Chymase Antibody (422818) [Unconjugated]](https://images.novusbio.com/images2/mab4099_human-chymase-cma1-mab-clone-422818-elisa-6122021135313.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")