Reactivity | Hu, RtSpecies Glossary |
Applications | WB |
Clone | 9W4A10 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 246-345 of human CEBP Beta (P17676). TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | CEBPB |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Transcription Factor Antibodies Used In Landmark Evolutionary Study We at Novus Biologicals offer a full antibody database targeted to transcription factor research. Recently, CEBP antibodieswere used in a research study exploring the evolution of gene regulation in various vertebrates. The results revealed surprising... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CEBPB |