EBP Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YEDLLGDQAFLSQLWKEYAKGDSRYILGDNF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
EBP |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:20 - 1:50
- Immunohistochemistry-Paraffin 1:20 - 1:50
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for EBP Antibody
Background
The protein encoded by the EBP gene is an integral membrane protein of the endoplasmic reticulum. It is a high affinity binding protein for the antiischemic phenylalkylamine Ca2+ antagonist (3H)emopamil and the photoaffinity label (3H)azidopamil. It is similar to sigma receptors and may be a member of a superfamily of high affinity drug-binding proteins in the endoplasmic reticulum of different tissues. This protein shares structural features with bacterial and eukaryontic drug transporting proteins. It has four putative transmembrane segments and contains two conserved glutamate residues which may be involved in the transport of cationic amphiphilics. Another prominent feature of this protein is its high content of aromatic amino acid residues (>23%) in its transmembrane segments. These aromatic amino acid residues have been suggested to be involved in the drug transport by the P-glycoprotein. Mutations in this gene cause Chondrodysplasia punctata 2 (CDPX2; also known as Conradi-Hunermann syndrome). (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Mu
Applications: ELISA
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Publications for EBP Antibody (NBP1-85699) (0)
There are no publications for EBP Antibody (NBP1-85699).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for EBP Antibody (NBP1-85699) (0)
There are no reviews for EBP Antibody (NBP1-85699).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for EBP Antibody (NBP1-85699) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional EBP Products
Research Areas for EBP Antibody (NBP1-85699)
Find related products by research area.
|
Blogs on EBP