Cdc23 Antibody Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Cdc23 (NP_004652.2).
Sequence: HSSKWSAELAFSLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMYSRYLSGEKKKDDETVDSLGPLEKGQVKNEA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CDC23 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin 1:100 - 1:200
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
69 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Cdc23 Antibody
Background
CDC23/APC8 is a component of the APC/c (anaphase promoting complex/cyclosome) which is responsible for the ubiquitination and degradation of securin and cyclin B that prompts the onset of anaphase and exit from mitosis. The APC/c is composed of at least 11 subunits. Three subunits, CDC27 CDC16 and CDC23, contain a TPR (tetratricopeptide repeat) important for protein-protein interactions.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IP, KD, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC
Publications for Cdc23 Antibody (NBP3-35501) (0)
There are no publications for Cdc23 Antibody (NBP3-35501).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cdc23 Antibody (NBP3-35501) (0)
There are no reviews for Cdc23 Antibody (NBP3-35501).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cdc23 Antibody (NBP3-35501) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cdc23 Products
Research Areas for Cdc23 Antibody (NBP3-35501)
Find related products by research area.
|
Blogs on Cdc23