![Immunocytochemistry/Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle. Antibody stainng is shown in green.](http://images.novusbio.com/fullsize/CDC7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-32708-img0007.jpg "Immunocytochemistry/Immunofluorescence: CDC7 Antibody [NBP2-32708] - Staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle. Antibody stainng is shown in green.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY |
| Predicted Species | Mouse (95%), Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDC7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
Simple Western | HCT116 cells | 08/27/2020 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for CDC7 Antibody (NBP2-32708)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 08/27/2020 |
||
| Application: | Simple Western | |
| Species: | HCT116 cells |
| Gene Symbol | CDC7 |
![Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/CDC7-Antibody-Immunohistochemistry-Paraffin-NBP2-32708-img0010.jpg "Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human lymph node shows moderate nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.](http://images.novusbio.com/fullsize/CDC7-Antibody-Immunohistochemistry-Paraffin-NBP2-32708-img0008.jpg "Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.")
![Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CDC7-Antibody-Immunohistochemistry-Paraffin-NBP2-32708-img0011.jpg "Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] -Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/antibody/nbp2-32708_rabbit-polyclonal-cdc7-antibody-immunohistochemistry-paraffin-278202410430..jpg "Immunohistochemistry-Paraffin: CDC7 Antibody [NBP2-32708] -Staining of human testis shows moderate nuclear positivity in cells in seminiferous ducts.")
![Western Blot Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Western_Blot_5130.jpg)
![Immunocytochemistry Chk2 [p Thr68] Antibody [Unconjugated]](https://images.novusbio.com/images2/Chk2_AF1626_Immunocytochemistry__Immunofluorescence_18847.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
