![Western Blot: SLC25A25 Antibody [NBP1-82886] - Analysis in rat cell line NBT-II and mouse cell line NIH-3T3.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Western-Blot-NBP1-82886-img0011.jpg "Western Blot: SLC25A25 Antibody [NBP1-82886] - Analysis in rat cell line NBT-II and mouse cell line NIH-3T3.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC25A25 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC25A25 |
![Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Immunohistochemistry-Paraffin-NBP1-82886-img0009.jpg "Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Western Blot: SLC25A25 Antibody [NBP1-82886] - Analysis in human cell line SCLC-21H.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Western-Blot-NBP1-82886-img0010.jpg "Western Blot: SLC25A25 Antibody [NBP1-82886] - Analysis in human cell line SCLC-21H.")
![Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Immunohistochemistry-Paraffin-NBP1-82886-img0006.jpg "Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Immunohistochemistry-Paraffin-NBP1-82886-img0007.jpg "Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.")
![Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/SLC25A25-Antibody-Immunohistochemistry-Paraffin-NBP1-82886-img0008.jpg "Immunohistochemistry-Paraffin: SLC25A25 Antibody [NBP1-82886] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Western Blot Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_C-II_AF4497_Western_Blot_5478.jpg)
![Simple Western Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_CII_AF4497_Simple_Western_17514.jpg)
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")