![Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining in human small intestine and skeletal muscle tissues using anti-SLC25A24 antibody. Corresponding SLC25A24 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SLC25A24-Antibody-Immunohistochemistry-Paraffin-NBP2-57669-img0006.jpg "Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining in human small intestine and skeletal muscle tissues using anti-SLC25A24 antibody. Corresponding SLC25A24 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL |
| Predicted Species | Mouse (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC25A24 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC25A24 |
![Western Blot: SLC25A24 Antibody [NBP2-57669] - Analysis using Anti-SLC25A24 antibody NBP2-57669 (A) shows similar pattern to independent antibody.](http://images.novusbio.com/fullsize/SLC25A24-Antibody-Western-Blot-NBP2-57669-img0008.jpg "Western Blot: SLC25A24 Antibody [NBP2-57669] - Analysis using Anti-SLC25A24 antibody NBP2-57669 (A) shows similar pattern to independent antibody.")
![Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP2-57669] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/SLC25A24-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57669-img0001.jpg "Immunocytochemistry/Immunofluorescence: SLC25A24 Antibody [NBP2-57669] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/SLC25A24-Antibody-Immunohistochemistry-Paraffin-NBP2-57669-img0004.jpg "Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/SLC25A24-Antibody-Immunohistochemistry-Paraffin-NBP2-57669-img0005.jpg "Immunohistochemistry-Paraffin: SLC25A24 Antibody [NBP2-57669] - Staining of human small intestine shows high expression.")
![Western Blot Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_C-II_AF4497_Western_Blot_5478.jpg)
![Simple Western Apolipoprotein C-II/ApoC2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_CII_AF4497_Simple_Western_17514.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")