![Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Analysis in human cerebral cortex and pancreas tissues using NBP1-89992 antibody. Corresponding BCAN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Brevican-Antibody-Immunohistochemistry-Paraffin-NBP1-89992-img0007.jpg "Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Analysis in human cerebral cortex and pancreas tissues using NBP1-89992 antibody. Corresponding BCAN RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ACYGDMDGFPGVRNYGVVDPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDHCSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BCAN |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
| Publication using NBP1-89992 | Applications | Species |
|---|---|---|
| Monticone M, Daga A, Candiani S et al. Identification of a novel set of genes reflecting different in vivo invasive patterns of human GBM cells. BMC Cancer 2012-08-17 [PMID: 22901239] |
Secondary Antibodies |
Isotype Controls |
Research Areas for Brevican Antibody (NBP1-89992)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BCAN |
![Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Brevican-Antibody-Immunohistochemistry-Paraffin-NBP1-89992-img0010.jpg "Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Cerebral cortex shows strong positivity in neuronal processes in neuropil.](http://images.novusbio.com/fullsize/Brevican-Antibody-Immunohistochemistry-Paraffin-NBP1-89992-img0008.jpg "Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Cerebral cortex shows strong positivity in neuronal processes in neuropil.")
![Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Brevican-Antibody-Immunohistochemistry-Paraffin-NBP1-89992-img0009.jpg "Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Brevican-Antibody-Immunohistochemistry-Paraffin-NBP1-89992-img0011.jpg "Immunohistochemistry-Paraffin: Brevican Antibody [NBP1-89992] - Staining of human Prostate shows no positivity in glandular cells as expected.")
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![N/A ADAMTS4 [Biotin]](https://images.novusbio.com/images2/DATA_ADAMTS4_DY430705_ELISA_2453.jpg)
![Western Blot Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Western_Blot_17244.jpg)
![Simple Western Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Simple_Western_17469.jpg)
![Immunohistochemistry Decorin Antibody [Unconjugated]](https://images.novusbio.com/images2/Decorin_AF143_Immunohistochemistry_17623.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-41202412401260.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241240223.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241239497.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")