![Western Blot: HAPLN2 Antibody [NBP1-91977] - Analysis in control (vector only transfected HEK293T lysate) and HAPLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Western-Blot-NBP1-91977-img0010.jpg "Western Blot: HAPLN2 Antibody [NBP1-91977] - Analysis in control (vector only transfected HEK293T lysate) and HAPLN2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DPASHPGPHYLLPPIHEVIHSHRGATATLPCVLGTTPPSYKVRWSKVEPGELRETLILITNGLH |
| Predicted Species | Mouse (94%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | HAPLN2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HAPLN2 Antibody (NBP1-91977)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HAPLN2 |
![Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining in human cerebral cortex and kidney tissues using NBP1-91977 antibody. Corresponding HAPLN2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Immunohistochemistry-Paraffin-NBP1-91977-img0015.jpg "Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining in human cerebral cortex and kidney tissues using NBP1-91977 antibody. Corresponding HAPLN2 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human cerebral cortex shows weak positivity in neuropil.](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Immunohistochemistry-Paraffin-NBP1-91977-img0011.jpg "Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human cerebral cortex shows weak positivity in neuropil.")
![Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Immunohistochemistry-Paraffin-NBP1-91977-img0012.jpg "Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Immunohistochemistry-Paraffin-NBP1-91977-img0013.jpg "Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human lymph node shows no positivity in non-germinal center cells as expected.")
![Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human rectum shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/HAPLN2-Antibody-Immunohistochemistry-Paraffin-NBP1-91977-img0014.jpg "Immunohistochemistry-Paraffin: HAPLN2 Antibody [NBP1-91977] - Staining of human rectum shows no positivity in glandular cells as expected.")
![Western Blot Brevican Antibody [Unconjugated]](https://images.novusbio.com/images2/Brevican_AF4009_Western_Blot_20591.jpg)
![Immunocytochemistry Brevican Antibody [Unconjugated]](https://images.novusbio.com/images2/Brevican_AF4009_Immunocytochemistry__Immunofluorescence_19520.jpg)
![Immunohistochemistry Brevican Antibody [Unconjugated]](https://images.novusbio.com/images2/Brevican_AF4009_Immunohistochemistry_19694.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/Versican_AF3054_Immunocytochemistry_6488.jpg)
![Immunocytochemistry Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images2/af3054_human-versican-affinity-purified-polyclonal-ab-immunocytochemistry-842022131824.jpg)
![Immunocytochemistry/ Immunofluorescence Versican Antibody [Unconjugated] - Isoform V0](https://images.novusbio.com/images/af3054_human-versican-affinity-purified-polyclonal-ab-22820241723618.jpg)
![Immunohistochemistry HAPLN4 Antibody [Unconjugated]](https://images.novusbio.com/images2/HAPLN4_AF4085_Immunohistochemistry_6822.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-41202412401260.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241240223.jpg)
![Immunocytochemistry/ Immunofluorescence HAPLN1 Antibody [Unconjugated]](https://images.novusbio.com/images/af2608_human-hapln1-affinity-purified-polyclonal-ab-4120241239497.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")