![Western Blot: RNF5 Antibody [NBP2-94913] - Analysis of extracts of various cell lines, using RNF5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.](http://images.novusbio.com/fullsize/RNF5-Antibody-Western-Blot-NBP2-94913-img0004.jpg "Western Blot: RNF5 Antibody [NBP2-94913] - Analysis of extracts of various cell lines, using RNF5 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RNF5 (NP_008844.1). MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RNF5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 19 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Chromatin Immunoprecipitation (ChIP) Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Chromatin_Immunoprecipitation_11228.jpg)
![Immunocytochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunocytochemistry_6637.jpg)
![Immunohistochemistry Olig2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Olig2_AF2418_Immunohistochemistry_17205.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RNF5 Antibody (NBP2-94913)Find related products by research area.
|
|
STING in Innate Immunity and Cancer: What’s the Buzz About? STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RNF5 |
![Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Rat liver using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNF5-Antibody-Immunohistochemistry-Paraffin-NBP2-94913-img0003.jpg "Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Rat liver using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Human liver cancer using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNF5-Antibody-Immunohistochemistry-Paraffin-NBP2-94913-img0001.jpg "Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Human liver cancer using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Mouse heart using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/RNF5-Antibody-Immunohistochemistry-Paraffin-NBP2-94913-img0002.jpg "Immunohistochemistry-Paraffin: RNF5 Antibody [NBP2-94913] - Mouse heart using RNF5 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images2/Nestin_MAB1259_Immunocytochemistry_6561.jpg)
![Intracellular Staining by Flow Cytometry Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/antibody/mab1259_human-nestin-mab-clone-196908-intracellular-staining-by-flow-cytometry-24120239959.jpg)
![Western Blot Nestin Antibody (196908) [Unconjugated]](https://images.novusbio.com/images/mab1259_human-nestin-mab-clone-196908-41202410481129.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")