![Western Blot: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Western blot analysis of extracts of various cell lines, using beta II Tubulin A Rabbit mAb (NBP3-16484) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.](http://images.novusbio.com/fullsize/beta-II-Tubulin-A-Antibody-1R3R9-Western-Blot-NBP3-16484-img0004.jpg "Western Blot: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Western blot analysis of extracts of various cell lines, using beta II Tubulin A Rabbit mAb (NBP3-16484) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 60s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clone | 1R3R9 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 346-445 of human beta II Tubulin A (Q13885). PNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TUBB2A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/16250.jpg)
![Immunocytochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/beta-III_Tubulin_MAB1195_Immunocytochemistry_6556.jpg)
![Immunohistochemistry beta-III Tubulin Antibody (TuJ-1) [Unconjugated] - Neuron-Specific](https://images.novusbio.com/images2/betaIII_Tubulin_MAB1195_Immunohistochemistry_22757.jpg)
![Simple Western GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Simple_Western_16530.jpg)
![Western Blot GCHFR Antibody (846011) [Unconjugated]](https://images.novusbio.com/images2/GCHFR_MAB7918_Western_Blot_13066.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for beta II Tubulin A Antibody (NBP3-16484)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TUBB2A |
![Immunocytochemistry/Immunofluorescence: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunofluorescence analysis of C6 cells using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/beta-II-Tubulin-A-Antibody-1R3R9-Immunocytochemistry-Immunofluorescence-NBP3-16484-img0003.jpg "Immunocytochemistry/Immunofluorescence: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunofluorescence analysis of C6 cells using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry-Paraffin: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunohistochemistry of paraffin-embedded mouse brain using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-II-Tubulin-A-Antibody-1R3R9-Immunohistochemistry-Paraffin-NBP3-16484-img0002.jpg "Immunohistochemistry-Paraffin: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunohistochemistry of paraffin-embedded mouse brain using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunohistochemistry of paraffin-embedded rat brain using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/beta-II-Tubulin-A-Antibody-1R3R9-Immunohistochemistry-Paraffin-NBP3-16484-img0001.jpg "Immunohistochemistry-Paraffin: beta II Tubulin A Antibody (1R3R9) [NBP3-16484] - Immunohistochemistry of paraffin-embedded rat brain using beta II Tubulin A Rabbit mAb (NBP3-16484) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Immunocytochemistry FUBI/MNSF beta/FAU Antibody (861504) [Unconjugated]](https://images.novusbio.com/images2/FUBI_MAB9036_Immunocytochemistry__Immunofluorescence_19164.jpg)
![Western Blot FUBI/MNSF beta/FAU Antibody (861504) [Unconjugated]](https://images.novusbio.com/images2/FUBI_MAB9036_Western_Blot_19167.jpg)
![Immunocytochemistry beta I Tubulin Antibody (923425) [Unconjugated]](https://images.novusbio.com/images2/betaI_Tubulin_MAB8527_Immunocytochemistry_16481.jpg)
![Western Blot beta I Tubulin Antibody (923425) [Unconjugated]](https://images.novusbio.com/images2/betaI_Tubulin_MAB8527_Western_Blot_16492.jpg)
![Immunohistochemistry beta I Tubulin Antibody (923425) [Unconjugated]](https://images.novusbio.com/images/antibody/mab8527_human-beta-i-tubulin-mab-clone-923425-immunohistochemistry-51202314282.jpg)
![Immunohistochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunohistochemistry_10417.jpg)
![Immunocytochemistry Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Immunocytochemistry_11095.jpg)
![Western Blot Plexin A1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A1_AF4309_Western_Blot_9601.jpg)
![Immunohistochemistry NOV/CCN3 Antibody [Unconjugated]](https://images.novusbio.com/images2/NOV_AF1640_Immunohistochemistry_7314.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")