![Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.](http://images.novusbio.com/fullsize/ATPB-Antibody-Western-Blot-NBP1-54700-img0005.jpg "Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the N terminal of ATP5B.
Peptide sequence PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ The peptide sequence for this immunogen was taken from within the described region. |
| Specificity | This product is specific to Subunit or Isoform: beta, mitochondrial. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ATP5F1B |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
| Publication using NBP1-54700 | Applications | Species |
|---|---|---|
| Yang HY, Kwon J, Kook MS et al. Proteomic analysis of gingival tissue and alveolar bone during alveolar bone healing. Mol Cell Proteomics. 2013-10-01 [PMID: 23824910] |
Secondary Antibodies |
Isotype Controls |
Research Areas for ATPB Antibody (NBP1-54700)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://images.novusbio.com/fullsize/ATPB-Antibody-Immunohistochemistry-Paraffin-NBP1-54700-img0006.jpg "Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.")
![Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.](http://images.novusbio.com/fullsize/ATPB-Antibody-Western-Blot-NBP1-54700-img0004.jpg "Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.")
![Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Intestine Epithelial cells of intestinal villus (Indicated with Arrows).](http://images.novusbio.com/fullsize/ATPB-Antibody-Immunohistochemistry-Paraffin-NBP1-54700-img0001.jpg "Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Intestine Epithelial cells of intestinal villus (Indicated with Arrows).")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")