![Immunocytochemistry/ Immunofluorescence: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunofluorescence analysis of HepG2 cells using Ubiquitin C Rabbit pAb (A3207) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94633_rabbit-polyclonal-ubiquitin-c-antibody-5220251930293.jpg "Immunocytochemistry/ Immunofluorescence: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunofluorescence analysis of HepG2 cells using Ubiquitin C Rabbit pAb (A3207) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UBC (NP_066289.3). MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 77 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Ubiquitin C Antibody (NBP2-94633)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UBC |
![Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded rat large intestine tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp2-94633_rabbit-polyclonal-ubiquitin-c-antibody-52202519294580.jpg "Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded rat large intestine tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded human spleen tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp2-94633_rabbit-polyclonal-ubiquitin-c-antibody-52202519302949.jpg "Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded human spleen tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded mouse large intestine tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp2-94633_rabbit-polyclonal-ubiquitin-c-antibody-5220251931346.jpg "Immunohistochemistry: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Immunohistochemistry analysis of Ubiquitin C in paraffin-embedded mouse large intestine tissue using Ubiquitin C Rabbit pAb (A3207) at a dilution of 1:100 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Western Blot: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Western blot analysis of various lysates using Ubiquitin C Rabbit pAb (A3207) at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution. Lysates / proteins: 25 μg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection:ECL Basic Kit (RM00020). Exposuretime: 45s.](http://images.novusbio.com/fullsize/nbp2-94633_rabbit-polyclonal-ubiquitin-c-antibody-5220251931389.jpg "Western Blot: Ubiquitin C Antibody - BSA Free [NBP2-94633] - Western blot analysis of various lysates using Ubiquitin C Rabbit pAb (A3207) at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution. Lysates / proteins: 25 μg per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection:ECL Basic Kit (RM00020). Exposuretime: 45s.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")