![Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355] - Analysis of extracts of various cell lines, using ATP5A Rabbit mAb (NBP3-15355) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/ATP5A-Antibody-6M3B8-Western-Blot-NBP3-15355-img0006.jpg "Western Blot: ATP5A Antibody (6M3B8) [NBP3-15355] - Analysis of extracts of various cell lines, using ATP5A Rabbit mAb (NBP3-15355) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ELISA, ICC/IF, IHC, IP |
| Clone | 6M3B8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ATP5A (P25705). VPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGSDEKKKLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | ATP5F1A |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Verified Customer |
Simple Western | Human | 04/06/2023 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ATP5A Antibody (NBP3-15355)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 04/06/2023 |
||
| Application: | Simple Western | |
| Species: | Human |
| Gene Symbol | ATP5F1A |
![Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] - ATP5A Antibodies (NBP3-15355), ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times. Image from verified customer review.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-simple-western-204202311391.jpg "Simple Western: ATP5A Antibody (6M3B8) [NBP3-15355] - ATP5A Antibodies (NBP3-15355), ProteinSimple Western Blot on Jess Instrument; 1, 0.5, and 0.2 microgram of human brain tissue lysate was tested with the antibodies diluted 20 times. Image from verified customer review.")
![Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-immunocytochemistry-immunofluorescence-412202412213..png "Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of NIH/3T3 cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -Rat brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-immunohistochemistry-paraffin-412202412333..png "Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] -Rat brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] - Mouse brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-immunohistochemistry-paraffin-412202412451..png "Immunohistochemistry-Paraffin: ATP5A Antibody (6M3B8) [NBP3-15355] - Mouse brain tissue using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) ( dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-immunocytochemistry-immunofluorescence-412202412651..png "Immunocytochemistry/Immunofluorescence: ATP5A Antibody (6M3B8) [NBP3-15355] - Confocal imaging of HeLa cells using ATP5A1 Rabbit mAb (dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (dilution 1:500) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517223956.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-5220251718967.jpg "Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Mouse brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of NIH/3T3 cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517251916.jpg "Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of NIH/3T3 cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517235715.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human lung squamous carcinoma tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-522025172603.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517223923.jpg "Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of paraffin-embedded Rat brain tissue using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of HeLa cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517202976.jpg "Immunocytochemistry/ Immunofluorescence: ATP5A Antibody (6M3B8) [ATP5A] - Confocal imaging of HeLa cells using ATP5A Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] - Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A antibody . Western blot was performed from the immunoprecipitate using ATP5A antibody at a dilution of 1:1000.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517162373.jpg "Immunoprecipitation: ATP5A Antibody (6M3B8) [ATP5A] - Immunoprecipitation analysis of 600 ug extracts of Mouse heart using 3 ug ATP5A antibody . Western blot was performed from the immunoprecipitate using ATP5A antibody at a dilution of 1:1000.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517152767.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517235771.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15355_rabbit-atp5a-mab-6m3b8-52202517202985.jpg "Immunohistochemistry: ATP5A Antibody (6M3B8) [ATP5A] - Immunohistochemistry analysis of paraffin-embedded Rat liver tissue using ATP5A Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Western_Blot_6125.jpg)
![Western Blot alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1Acid_Glycoprotein_MAB3694_Western_Blot_21887.jpg)
![Immunohistochemistry alpha 1-Acid Glycoprotein Antibody (386131) [Unconjugated]](https://images.novusbio.com/images2/alpha_1-Acid_Glycoprotein_MAB3694_Immunohistochemistry_9988.jpg)
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/DATA_Fetuin_A_DFTA00_ELISA_684.jpg)
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/DATA_Fetuin_A_DFTA00_ELISA_685.jpg)
![N/A Fetuin A/AHSG [HRP]](https://images.novusbio.com/images2/Fetuin_A_DFTA00_ELISA_99.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/DATA_Coagulation_Factor_III_DCF300_ELISA_625.jpg)
![N/A Coagulation Factor III/Tissue Factor [HRP]](https://images.novusbio.com/images2/Coagulation_Factor_III_DCF300_ELISA_61.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/IL-5_M5000_ELISA_237.jpg)
![N/A IL-5 [HRP]](https://images.novusbio.com/images2/DATA_IL5_M5000_ELISA_935.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_40.jpg)
![Bioactivity IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_41.jpg)
![Mass Spectrometry IGF-I/IGF-1 [Unconjugated]](https://images.novusbio.com/images2/IGF-I_291-G1_42.jpg)
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A C-Reactive Protein/CRP [Biotin]](https://images.novusbio.com/images2/DATA_CReactive_Protein_DY1707_ELISA_1701.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Simple Western alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Simple_Western_20705.jpg)
![Western Blot alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Western_Blot_20706.jpg)
![Immunocytochemistry alpha 2-Macroglobulin Antibody [Unconjugated]](https://images.novusbio.com/images2/alpha_2Macroglobulin_AF1938_Immunocytochemistry__Immunofluorescence_17394.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
