Home » Adiponectin/Acrp30 » Adiponectin/Acrp30 Proteins » Adiponectin/Acrp30 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Adiponectin/Acrp30 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Adiponectin/Acrp30 Protein (NBP2-38657PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Adiponectin/Acrp30 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADIPOQ.

Source: E. coli

Amino Acid Sequence: YMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADIPOQ
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38657.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Adiponectin/Acrp30 Recombinant Protein Antigen

  • ACDC
  • Acrp30
  • ACRP30ADPN
  • adipocyte, C1Q and collagen domain containing
  • Adiponectin
  • adiponectin, C1Q and collagen domain containing
  • AdipoQ
  • ADIPQTL1
  • ApM1
  • apM-1
  • APM1APM-1
  • C1q and collagen domain-containing protein
  • GBP28
  • GBP28apM1
  • Gelatin-binding protein

Background

Adipose cells produce and secrete numerous physiologically important proteins, such as Lipoprotein Lipase, Leptin, and Adipocyte Complement Related protein of 30 kDa, also known as Acrp30 or Adiponectin. Adiponectin is a circulating protein that is secreted exclusively by differentiated adipocytes. During adipocyte differentiation, Adiponectin mRNA is induced >100 fold. Adiponectin improves the ability of insulin to suppress glucose production, at sub physiological levels, thereby linking adipose tissue to whole body glucose regulation. Adiponectin function appears to be regulated by phosphatidylinositol 3 kinase (PI3K) since Adiponectin secretion is blocked by pharmacologic inhibitors of this kinase. Adiponectin mRNA is significantly reduced in adipose tissue of obese patients with Type 2 diabetes. The structural similarity of Adiponectin to TNF alpha suggests that Adiponectin may play a role in pathogenesis of insulin resistance in Type 2 diabetes. Adiponectin is implicated as a regulator of whole body energy homeostasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(155 Publications)
Species: Hu
Applications: ELISA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(809 Publications)
Species: Hu
Applications: BA
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(643 Publications)
Species: Mu
Applications: ELISA
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(68 Publications)
Species: Hu
Applications: ELISA
Resistin [HRP]
DRSN00
N/A Resistin [HRP]
N/A Resistin [HRP]
(45 Publications)
Species: Hu
Applications: ELISA
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
AdipoR1 Antibody
(SC69-04)
NBP2-67631
Flow Cytometry AdipoR1 Antibody (SC69-04)
Immunocytochemistry/ Immunofluorescence AdipoR1 Antibody (SC69-04)
Immunocytochemistry/ Immunofluorescence AdipoR1 Antibody (SC69-04)
(4 Publications)
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CCL2/JE/MCP-1 [HRP]
DCP00
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
N/A CCL2/JE/MCP-1 [HRP]
(254 Publications)
Species: Hu
Applications: ELISA
CSRP1 Antibody
AF5739
Western Blot CSRP1 Antibody
Species: Hu, Mu, Rt
Applications: WB

PBEF/Visfatin/NAMPT An
NB100-594
Western Blot PBEF/Visfatin/NAMPT Antibody
Western Blot PBEF/Visfatin/NAMPT Antibody
Immunohistochemistry-Paraffin PBEF/Visfatin/NAMPT Antibody
(10 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Serpin E1/PAI-1
Antibody - BSA Free
NBP1-19773
Western Blot Serpin E1/PAI-1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Serpin E1/PAI-1 Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin E1/PAI-1 Antibody - BSA Free
(2 Reviews)
(32 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AMPK alpha 1
Antibody (2B7) - BSA
NBP2-22127
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
Flow Cytometry AMPK alpha 1 Antibody (2B7) - BSA Free
ELISA AMPK alpha 1 Antibody (2B7) - BSA Free
(12 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AMPK alpha 2
Antibody [Unconjugate
AF2850
Western Blot AMPK alpha 2 Antibody [Unconjugated]
Simple Western AMPK alpha 2 Antibody [Unconjugated]
Immunocytochemistry AMPK alpha 2 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AMPK beta 1
Antibody [Unconjugate
AF2854
Western Blot AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
Immunohistochemistry AMPK beta 1 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Ghrelin Antibody
(883622)
MAB8200
Immunohistochemistry Ghrelin Antibody (883622)
Immunohistochemistry Ghrelin Antibody (883622)
(11 Publications)
Species: Hu, Mu
Applications: IHC
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(221 Publications)
Species: Hu
Applications: BA
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(16 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Adiponectin/Acrp30
Recombinant Protein A ...
NBP2-38657PEP
Adiponectin/Acrp30 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no publications for Adiponectin/Acrp30 Protein (NBP2-38657PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no reviews for Adiponectin/Acrp30 Protein (NBP2-38657PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Adiponectin/Acrp30 Protein (NBP2-38657PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Adiponectin/Acrp30 Products

Research Areas for Adiponectin/Acrp30 Protein (NBP2-38657PEP)

Find related products by research area.

Blogs on Adiponectin/Acrp30

There are no specific blogs for Adiponectin/Acrp30, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Adiponectin/Acrp30 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ADIPOQ