Home » ZFYVE9 » ZFYVE9 Antibodies » ZFYVE9 Antibody - BSA Free
Novus Biologicals products are now on bio-techne.com

ZFYVE9 Antibody - BSA Free

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: ZFYVE9 Antibody [NBP2-57521] - Staining of human cell line RT4 shows localization to cytosol & vesicles.
Immunocytochemistry/ Immunofluorescence: ZFYVE9 Antibody [NBP2-57521] - Staining of human cell line RT4 shows localization to cytosol & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price
BSA Free
NBP2-57521-25ul
Novus Biologicals offers 100% Guarantee

ZFYVE9 Antibody - BSA Free Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFYVE9
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFYVE9 Recombinant Protein Antigen (NBP2-57521PEP)

Reactivity Notes

Mouse 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZFYVE9 Antibody - BSA Free

  • Madh-interacting protein
  • MADHIP
  • mothers against decapentaplegic homolog interacting protein
  • mothers against decapentaplegic homolog interacting protein, receptoractivation anchor
  • NSP
  • receptor activation anchor
  • SARAhSARA
  • Smad anchor for receptor activation
  • SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein
  • zinc finger FYVE domain-containing protein 9
  • zinc finger, FYVE domain containing 9

Background

ZFYVE9 encodes a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SMAD proteins transmit signals from transmembrane serine/threonine kinase receptors to the nucleus. The FYVE domain has been identified in a number of unrelated signaling molecules. This protein functions to recruit SMAD2 to the transforming growth factor-beta receptor. The FYVE domain is required to maintain the normal localization of this protein but is not involved in mediating interaction with SMADs. The C-terminal domain of this protein interacts with the TGFB receptor. This protein is a component of the TGFB pathway that brings the SMAD substrate to the receptor. Three alternatively spliced transcripts encoding distinct isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZFYVE16 Antibody -
BSA Free
NBP1-81516
Immunohistochemistry-Paraffin ZFYVE16 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence ZFYVE16 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Smad2/3 Antibody
[Unconjugated]
AF3797
Western Blot Smad2/3 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) Smad2/3 Antibody [Unconjugated]
Immunocytochemistry Smad2/3 Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu, Mu
Applications: ChIP, ICC, IHC, Simple Western, WB
TFF2 Antibody
(366508) [Unconjugate
MAB4077
Immunohistochemistry TFF2 Antibody (366508) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
PXR/NR1I2 Antibody
(H4417) [Unconjugated ...
PP-H4417-00
PXR/NR1I2 Antibody (H4417) [Unconjugated]
(2 Publications)
Species: Hu
Applications: DirELISA, IP, WB
Smad3 Antibody -
BSA Free
NB100-56479
Immunocytochemistry/ Immunofluorescence Smad3 Antibody - BSA Free
Western Blot Smad3 Antibody - BSA Free
Immunohistochemistry-Paraffin Smad3 Antibody - BSA Free
(5 Reviews)
(8 Publications)
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Exosome component
10 Antibody - BSA Fre ...
NBP1-32870
Western Blot Exosome component 10 Antibody - BSA Free
Immunohistochemistry-Paraffin Exosome component 10 Antibody - BSA Free
Western Blot Exosome component 10 Antibody - BSA Free
(2 Reviews)
(3 Publications)
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
RTN1-A/NSP
Antibody (MON162) - B
NBP1-97677
Immunocytochemistry/ Immunofluorescence RTN1-A/NSP Antibody (MON162) - BSA Free
Immunohistochemistry-Frozen RTN1-A/NSP Antibody (MON162) - BSA Free
(1 Publication)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Smad4 Antibody
[Unconjugated]
AF2097
Chromatin Immunoprecipitation (ChIP) Smad4 Antibody [Unconjugated]
Western Blot Smad4 Antibody [Unconjugated]
Immunocytochemistry Smad4 Antibody [Unconjugated]
(9 Publications)
Species: Hu
Applications: ChIP, ICC, WB
TGF-beta RI/ALK-5
Antibody [Unconjugate ...
AF3025
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
Immunocytochemistry TGF-beta RI/ALK-5 Antibody [Unconjugated]
Western Blot TGF-beta RI/ALK-5 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ELISA, ICC, WB
HGS Antibody
(6D11) - Azide and BS ...
H00009146-M01
Immunocytochemistry/ Immunofluorescence HGS Antibody (6D11) - Azide and BSA Free
Western Blot HGS Antibody (6D11) - Azide and BSA Free
Sandwich ELISA HGS Antibody (6D11) - Azide and BSA Free
(2 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, KD, S-ELISA, WB
TGF-beta 1
[Unconjugated]
7754-BH/CF
Bioactivity TGF-beta 1 [Unconjugated]
(53 Publications)
Species: Hu
Applications: BA
Filamin A Antibody
(4E10-1B2) - Azide an ...
H00002316-M01
Western Blot Filamin A Antibody (4E10-1B2) - Azide and BSA Free
ELISA Filamin A Antibody (4E10-1B2) - Azide and BSA Free
Proximity Ligation Assay Filamin A Antibody (4E10-1B2) - Azide and BSA Free
(14 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, PLA, WB
SLC10A3 Antibody -
BSA Free
NBP1-84957
Western Blot SLC10A3 Antibody - BSA Free
Immunohistochemistry-Paraffin SLC10A3 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Recombinant Human
ATP5G3 GST (N-Term) P ...
H00000518-P01
SDS-PAGE Recombinant Human ATP5G3 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Western Blot Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Ataxin-3 Antibody
(HL1909) - Azide and ...
NBP3-25371
Immunohistochemistry-Paraffin Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Western Blot Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Western Blot Ataxin-3 Antibody (HL1909) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RPLP2 Antibody
NBP2-15104
Immunocytochemistry/ Immunofluorescence RPLP2 Antibody
Immunohistochemistry-Paraffin RPLP2 Antibody
Western Blot RPLP2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ZFYVE9 Antibody (NBP2-57521) (0)

There are no publications for ZFYVE9 Antibody (NBP2-57521).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFYVE9 Antibody (NBP2-57521) (0)

There are no reviews for ZFYVE9 Antibody (NBP2-57521). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ZFYVE9 Antibody (NBP2-57521) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFYVE9 Products

Research Areas for ZFYVE9 Antibody (NBP2-57521)

Find related products by research area.

Blogs on ZFYVE9

There are no specific blogs for ZFYVE9, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFYVE9 Antibody - BSA Free and receive a gift card or discount.


Bioinformatics

Gene Symbol ZFYVE9