![Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.](http://images.novusbio.com/fullsize/HGS-Antibody-6D11-Western-Blot-H00009146-M01-img0010.jpg "Western Blot: HGS Antibody (6D11) [H00009146-M01] - HGS monoclonal antibody (M01), clone 6D11 Analysis of HGS expression in K-562.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ELISA, Flow, ICC/IF, KD |
| Clone | 6D11 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | HGS (AAH03565, 513 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLEIMRQKKQEYLEVQRQLAIQRLQEQEKERQMRLEQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQP |
| Specificity | HGS - hepatocyte growth factor-regulated tyrosine kinase substrate |
| Isotype | IgG1 Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | HGS |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence, RNAi validation and ELISA. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Western Blot EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Western_Blot_16272.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16281.jpg)
![Immunocytochemistry EPS15 Antibody [Unconjugated]](https://images.novusbio.com/images2/Eps15_AF8480_Immunocytochemistry_16416.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HGS Antibody (H00009146-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/HGS-Antibody-6D11-Immunocytochemistry-Immunofluorescence-H00009146-M01-img0006.jpg "Immunocytochemistry/Immunofluorescence: HGS Antibody (6D11) [H00009146-M01] - Analysis of monoclonal antibody to HGS on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody (M01), clone 6D11 (Cat # H00009146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://images.novusbio.com/fullsize/HGS-Antibody-6D11-Western-Blot-H00009146-M01-img0008.jpg "Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS over-expressed 293 cell line, cotransfected with HGS Validated Chimera RNAi ( Cat # H00009146-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with HGS monoclonal antibody (M01), clone 6D11 (Cat # H00009146-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.")
![Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/HGS-Antibody-6D11-Western-Blot-H00009146-M01-img0011.jpg "Western Blot: HGS Antibody (6D11) [H00009146-M01] - Analysis of HGS expression in transfected 293T cell line by HGS monoclonal antibody (M01), clone 6D11.Lane 1: HGS transfected lysate(86.2 KDa).Lane 2: Non-transfected lysate.")
![Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/HGS-Antibody-6D11-Sandwich-ELISA-H00009146-M01-img0009.jpg "Sandwich ELISA: HGS Antibody (6D11) [H00009146-M01] - Detection limit for recombinant GST tagged HGS is approximately 0.03ng/ml as a capture antibody.")
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot Hairless Antibody [Unconjugated]](https://images.novusbio.com/images2/Hairless_AF5708_Western_Blot_5811.jpg)
![Immunocytochemistry Hairless Antibody [Unconjugated]](https://images.novusbio.com/images2/Hairless_AF5708_Immunocytochemistry_6520.jpg)
![Bioactivity HGF [Unconjugated]](https://images.novusbio.com/images2/HGF_294HG_3253.jpg)
![Cell Culture HGF [Unconjugated]](https://images.novusbio.com/images/294-hg_recombinant-human-hgf-protein-cell-culture-252023111456.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.](https://images.novusbio.com/images/Mouse-IgG1-Kappa-Light-Chain-Isotype-Control-P3-6-2-8-1-Flow-Cytometry-NBP1-43319-img0002.jpg "Flow Cytometry: Mouse IgG1 Kappa Isotype Control (P3.6.2.8.1) [NBP1-43319] - Analysis of Alexa Fluor (R) 700 conjugate of NBP1-43319. Human buffy coat stained with mouse IgG1 Kappa isotype control. Flow cytometry image submitted by a verified customer review.")