Home » XPF » XPF Proteins » XPF Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

XPF Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for XPF Recombinant Protein Antigen (NBP2-58407PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

XPF Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human XPF.

Source: E. coli

Amino Acid Sequence: SKPQPDAATALAITADSETLPESEKYNPGPQDFLLKMPGVNAKNCRSLMHHVKNIAELAALSQDELTSILGNAANAKQLYDFIHTSFAEVVSKGKGK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ERCC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58407.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for XPF Recombinant Protein Antigen

  • DNA excision repair protein ERCC-4
  • DNA repair protein complementing XP-F cells
  • EC 3.1
  • ERCC11
  • ERCC4
  • excision repair cross-complementing rodent repair deficiency, complementationgroup 4
  • xeroderma pigmentosum, complementation group F
  • XPF
  • XPFcomplementing defective, in Chinese hamster

Background

XPF/ERCC4 is suggested to play a role in the repair of DNA double-strand breaks (DSB), homologous recombination, and gene conversion via single-strand annealing (SSA). XPF/ERCC4 is an endonuclease that incises 5-prime DNA. Defects in XPF/ERCC4 cause xeroderma pigmentosum VI (XP6) an autosomal recessive disease characterized by hypersensitivity to sunlight and a predisposition to skin cancer as well as neurological abnormalities. Defects in XPF/ERCC4 are also responsible for XFE progeroid syndrome, a syndrome characterized by dwarfism, cachexia, and microcephaly.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERCC1 Antibody
(8F1) - BSA Free
NB500-704
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
Immunohistochemistry-Paraffin ERCC1 Antibody (8F1) - BSA Free
(1 Review)
(17 Publications)
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
XPG Antibody
NB100-74611
Immunoprecipitation XPG Antibody
Western Blot XPG Antibody
Immunohistochemistry-Paraffin XPG Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
XPD Antibody
AF3296
Western Blot XPD Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
XPC Antibody (3.26)
NB100-477
Immunocytochemistry/ Immunofluorescence XPC Antibody (3.26)
Western Blot XPC Antibody (3.26)
Western Blot XPC Antibody (3.26)
(1 Review)
(21 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Rad9 Antibody
(93A535) - BSA Free
NB120-13600
Western Blot Rad9 Antibody (93A535) - BSA Free
Immunohistochemistry-Paraffin Rad9 Antibody (93A535) - BSA Free
(8 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
HUS1 Antibody
NBP1-33589
Immunohistochemistry-Paraffin HUS1 Antibody
Western Blot HUS1 Antibody
Western Blot HUS1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
XPA Antibody
AF3416
Western Blot XPA Antibody
(1 Publication)
Species: Hu
Applications: WB
RAD52 Antibody
NBP2-58116
Western Blot RAD52 Antibody
Immunocytochemistry/ Immunofluorescence RAD52 Antibody
(1 Review)
(1 Publication)
Species: Hu
Applications: ICC/IF, KD, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(45 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
LXR beta/NR1H2
Antibody
NB100-74457
Western Blot LXR beta/NR1H2 Antibody
Immunocytochemistry/ Immunofluorescence LXR beta/NR1H2 Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
XPB Antibody
NB100-61060
Immunoprecipitation XPB Antibody
Western Blot XPB Antibody
Western Blot XPB Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
FEN-1 Antibody
(4E7)
NB100-150
Western Blot FEN-1 Antibody (4E7)
Immunocytochemistry/ Immunofluorescence FEN-1 Antibody (4E7)
(21 Publications)
Species: Hu, Mu
Applications: ChIP, ICC/IF, IP, WB
Rad17 [p Ser645]
Antibody
NBP2-24457
Western Blot Rad17 [p Ser645] Antibody
Immunohistochemistry-Paraffin Rad17 [p Ser645] Antibody
Western Blot Rad17 [p Ser645] Antibody
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
Western Blot Rad51 Antibody (14B4)
(5 Reviews)
(63 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
CSB Antibody
NBP1-32405
Immunohistochemistry-Paraffin CSB Antibody
Immunohistochemistry-Paraffin CSB Antibody
Immunoprecipitation CSB Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Chk1 Antibody
NB100-464
Immunoprecipitation Chk1 Antibody
Immunohistochemistry-Paraffin Chk1 Antibody
Western Blot Chk1 Antibody
(12 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
XRCC1 Antibody
NBP1-87154
Immunohistochemistry-Paraffin XRCC1 Antibody
Immunohistochemistry-Paraffin XRCC1 Antibody
Immunohistochemistry-Paraffin XRCC1 Antibody
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Mus81 Antibody -
BSA Free
NBP2-95212
Immunohistochemistry-Paraffin Mus81 Antibody - BSA Free
Western Blot Mus81 Antibody - BSA Free
Immunohistochemistry-Paraffin Mus81 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
XRCC3 Antibody -
BSA Free
NB100-165
Western Blot XRCC3 Antibody - BSA Free
Western Blot XRCC3 Antibody - BSA Free
(1 Review)
(18 Publications)
Species: Dr, Ha, Hu
Applications: ICC/IF (-), IP, WB

Publications for XPF Recombinant Protein Antigen (NBP2-58407PEP) (0)

There are no publications for XPF Recombinant Protein Antigen (NBP2-58407PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XPF Recombinant Protein Antigen (NBP2-58407PEP) (0)

There are no reviews for XPF Recombinant Protein Antigen (NBP2-58407PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for XPF Recombinant Protein Antigen (NBP2-58407PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional XPF Products

Array NBP2-58407PEP

Research Areas for XPF Recombinant Protein Antigen (NBP2-58407PEP)

Find related products by research area.

Blogs on XPF.

Check out the latest blog posts on XPF.
NER Antibodies in Cancer Research
We at Novus Biologicals have over 230 products in our antibody catalog devoted to nucleotide excision repair. NER is a multi-stage sequential process involving over 30 proteins, all of which have been widely studied. Being the primary method to repair...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Rad51 Antibody (14B4)
NB100-148
Immunocytochemistry/Immunofluorescence: PCNA Antibody (PC10) [NB500-106] - HeLa cells were fixed and permeabilized for 10 minutes using cold (-20C) MeOH. The cells were incubated with anti-PCNA [PC10] at 5 ug/mL overnight at 4C and detected with an anti-mouse IgG Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
PCNA Antibody (PC10)
NB500-106
Immunohistochemistry-Paraffin: ERCC1 Antibody (8F1) [NB500-704] - Anti-ERCC1 immunohistochemistry on whole sections of a lung squamous cell carcinoma, using Mab 8F1 and D-10 with CC1-mono and H2-60 protocols. Note increased cytosolic background with H2-60. Arrow: Necrotic centre. Arrowhead: Stromal axis. 100 A- original magnification. Image collected and cropped by Citeab from the following publication (Automated ERCC1 immunochemistry on hybrid cytology/tissue microarray of malignant effusions: evaluation of antibodies 8F1 and D-10. J Clin Bioinforma (2011) licensed under a CC-BY license.
ERCC1 Antibody (8F1) - BSA Free
NB500-704

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our XPF Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ERCC4