Home » WISP3 » WISP3 Proteins » WISP3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

WISP3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for WISP3 Recombinant Protein Antigen (NBP2-69068PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

WISP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human WISP3.

Source: E. coli

Amino Acid Sequence: GTGPLDTTPEGRPGEVSDAPQRKQFCHWPCKCPQQKPRCPPGV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CCN6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-69068.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for WISP3 Recombinant Protein Antigen

  • CCN family member 6
  • CCN6
  • CCN6MGC125988
  • LIBC
  • MGC125987
  • MGC125989
  • PPAC
  • PPD
  • WISP3
  • WISP-3
  • WNT1 inducible signaling pathway protein 3
  • WNT1-inducible-signaling pathway protein 3

Background

The WISP3 gene encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate di

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lamin B Receptor
Antibody
H00003930-B01P
Western Blot Lamin B Receptor Antibody
Immunocytochemistry/ Immunofluorescence Lamin B Receptor Antibody
Immunohistochemistry-Paraffin Lamin B Receptor Antibody
(1 Review)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(451 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(811 Publications)
Species: Hu
Applications: BA
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(301 Publications)
Species: Mu
Applications: ELISA
PIST Antibody
NBP1-88223
Immunocytochemistry/ Immunofluorescence PIST Antibody
Western Blot PIST Antibody
Western Blot PIST Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Migfilin Antibody
NBP1-86665
Immunohistochemistry-Paraffin Migfilin Antibody
Immunohistochemistry-Paraffin Migfilin Antibody
Immunohistochemistry-Paraffin Migfilin Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot G protein alpha inhibitor 1 Antibody (2B8-2A5)
Immunohistochemistry-Paraffin G protein alpha inhibitor 1 Antibody (2B8-2A5)
Sandwich ELISA G protein alpha inhibitor 1 Antibody (2B8-2A5)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
CTGF/CCN2 Antibody
[Unconjugated] - C-te ...
AF660
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Immunohistochemistry CTGF/CCN2 Antibody [Unconjugated] - C-terminus
Western Blot CTGF/CCN2 Antibody [Unconjugated] - C-terminus
(7 Publications)
Species: Hu
Applications: IHC
IL-5 [HRP]
M5000
N/A IL-5 [HRP]
N/A IL-5 [HRP]
(92 Publications)
Species: Mu
Applications: ELISA
S Opsin Antibody -
Azide and BSA Free
NBP1-20194
Immunohistochemistry-Paraffin S Opsin Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin S Opsin Antibody - Azide and BSA Free
Western Blot S Opsin Antibody - Azide and BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
EYA1 Antibody
NBP2-87382
Immunohistochemistry EYA1 Antibody
Western Blot EYA1 Antibody
Western Blot EYA1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
SmyD1 Antibody
NBP2-20428
Western Blot SmyD1 Antibody
Western Blot SmyD1 Antibody
Immunohistochemistry-Paraffin SmyD1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(660 Publications)
Species: Mu
Applications: ELISA
Cyr61/CCN1
Antibody [Unconjugate
AF4055
Western Blot Cyr61/CCN1 Antibody [Unconjugated]
Immunohistochemistry Cyr61/CCN1 Antibody [Unconjugated]
Simple Western Cyr61/CCN1 Antibody [Unconjugated]
(13 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
TST Antibody
NBP1-87148
Immunohistochemistry-Paraffin TST Antibody
Immunohistochemistry-Paraffin TST Antibody
Immunohistochemistry-Paraffin TST Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
WISP3 Recombinant
Protein Antigen
NBP2-69068PEP
WISP3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for WISP3 Recombinant Protein Antigen (NBP2-69068PEP) (0)

There are no publications for WISP3 Recombinant Protein Antigen (NBP2-69068PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WISP3 Recombinant Protein Antigen (NBP2-69068PEP) (0)

There are no reviews for WISP3 Recombinant Protein Antigen (NBP2-69068PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for WISP3 Recombinant Protein Antigen (NBP2-69068PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional WISP3 Products

Array NBP2-69068PEP

Research Areas for WISP3 Recombinant Protein Antigen (NBP2-69068PEP)

Find related products by research area.

Blogs on WISP3

There are no specific blogs for WISP3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our WISP3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CCN6